Protein Info for GFF2434 in Xanthobacter sp. DMC5

Annotation: Glycine oxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 401 PF01266: DAO" amino acids 27 to 374 (348 residues), 251.1 bits, see alignment E=6.4e-78 TIGR02352: glycine oxidase ThiO" amino acids 28 to 379 (352 residues), 351.1 bits, see alignment E=3.5e-109 PF00890: FAD_binding_2" amino acids 28 to 282 (255 residues), 25.1 bits, see alignment E=2.6e-09 PF13450: NAD_binding_8" amino acids 30 to 58 (29 residues), 25.5 bits, see alignment (E = 3.2e-09)

Best Hits

KEGG orthology group: K03153, glycine oxidase [EC: 1.4.3.19] (inferred from 82% identity to xau:Xaut_2223)

Predicted SEED Role

"Glycine oxidase ThiO (EC 1.4.3.19)" in subsystem Thiamin biosynthesis (EC 1.4.3.19)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.3.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (401 amino acids)

>GFF2434 Glycine oxidase (Xanthobacter sp. DMC5)
MSESLSQFTSAPSSQAGSAPAGKAKPRVAIVGGGVIGLALAWRLADAGCPVDLFEAGETG
EGASRAAAGMLAACAEAEPGEEGLLALNCASQTLWPAFAAELERASGEVVDLRTEGTITI
ALTADDLAKLRHLYAFQQGLGLPVQWLTAAEVRRREPYLAPRLAGGVLSPEDHQVDNRKV
AAALKIAALKAGATIHQNTPVSRVETAGGRATGIVTGETHHAADVVVLAAGAWSRGVDIT
PARPLPVRPIKGQMLSLRMDPAAPILSHVLWAPGSYLVPRRDGRLIIGATTEEKGFDTDL
TAGGQLALLTNAWRALPTLEELSIVEQWVGFRPGSRDDAPILGPSPEVDGLVYATGHHRN
GILLLPVTTQVIADHILGGKIADVALPFGAERFGPPRAAAE