Protein Info for GFF2434 in Sphingobium sp. HT1-2

Annotation: CDP-diacylglycerol--serine O-phosphatidyltransferase (EC 2.7.8.8) @ Archaetidylserine synthase (EC 2.7.8.38)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 47 to 65 (19 residues), see Phobius details amino acids 82 to 101 (20 residues), see Phobius details amino acids 107 to 128 (22 residues), see Phobius details amino acids 140 to 162 (23 residues), see Phobius details amino acids 173 to 194 (22 residues), see Phobius details amino acids 205 to 222 (18 residues), see Phobius details amino acids 228 to 247 (20 residues), see Phobius details PF01066: CDP-OH_P_transf" amino acids 19 to 174 (156 residues), 83.3 bits, see alignment E=2.5e-27 PF08009: CDP-OH_P_tran_2" amino acids 205 to 240 (36 residues), 36 bits, see alignment 5.5e-13

Best Hits

KEGG orthology group: K00998, phosphatidylserine synthase [EC: 2.7.8.8] (inferred from 87% identity to sch:Sphch_1340)

Predicted SEED Role

"CDP-diacylglycerol--serine O-phosphatidyltransferase (EC 2.7.8.8)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.8.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.8.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (255 amino acids)

>GFF2434 CDP-diacylglycerol--serine O-phosphatidyltransferase (EC 2.7.8.8) @ Archaetidylserine synthase (EC 2.7.8.38) (Sphingobium sp. HT1-2)
VRQRRAVPRGLRRGITLRMLAPNAVTAMALCFGLTGVRYGISGEWERAVLSILFAGVLDG
LDGRIARMLRGESRFGAELDSLSDSIAFGVAPALILYLWSLHAMPKFGWIFALAHALSCA
LRLARFNANIDVEEQPHKSAGFLTGVPAPAGAGLTFVPLYLWMVTGEEIFRAWYVVAPWT
AFVAFLMISSIATYSWSALRLRKRIRLELIAFVGLLAAALATQPWFTLLLICGVYVLLIP
FGILSYAKVRKQPVG