Protein Info for GFF2432 in Xanthobacter sp. DMC5
Annotation: Thiazole synthase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 94% identical to THIG_AZOC5: Thiazole synthase (thiG) from Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571)
KEGG orthology group: K03149, thiamine biosynthesis ThiG (inferred from 96% identity to xau:Xaut_2225)MetaCyc: 49% identical to 1-deoxy-D-xylulose 5-phosphate:thiol sulfurtransferase (Escherichia coli K-12 substr. MG1655)
THIAZOLSYN2-RXN [EC: 2.8.1.10]
Predicted SEED Role
"Thiazole biosynthesis protein ThiG" in subsystem Thiamin biosynthesis
MetaCyc Pathways
- superpathway of thiamine diphosphate biosynthesis II (9/11 steps found)
- thiazole component of thiamine diphosphate biosynthesis II (5/7 steps found)
- superpathway of thiamine diphosphate biosynthesis I (7/10 steps found)
- thiazole component of thiamine diphosphate biosynthesis I (3/6 steps found)
Isozymes
No predicted isozymesUse Curated BLAST to search for 2.8.1.10
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (263 amino acids)
>GFF2432 Thiazole synthase (Xanthobacter sp. DMC5) MSAFQNPNVDPLVIAGRTFSSRLFLGTAGYPNQKVFLDALAASGSEMATASIRRISLAGY EESLTDLLTGRVHILPNTAGCQTAKDAVLTAELAREALETDWVKLEVIGDRELLYPNVEE LLKATEELVSRGFVVLPYCNDDPVTCQKLADLGAATVMPLGSMIGTGLGIANPHMIELIC SRSPVPVVLDAGIGTASDAALAMELGCSAVLLNTAVSKALDPVRMATAFRHAVEAGRLAR LAGRIPRKLHAEASSPEFGLVGS