Protein Info for GFF2432 in Sphingobium sp. HT1-2
Annotation: SSU ribosomal protein S2p (SAe)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 86% identical to RS2_NOVAD: 30S ribosomal protein S2 (rpsB) from Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CIP 105152 / NBRC 16084 / F199)
KEGG orthology group: K02967, small subunit ribosomal protein S2 (inferred from 96% identity to sjp:SJA_C1-24160)MetaCyc: 58% identical to 30S ribosomal subunit protein S2 (Escherichia coli K-12 substr. MG1655)
Predicted SEED Role
"SSU ribosomal protein S2p (SAe)" in subsystem Ribosome SSU bacterial
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (252 amino acids)
>GFF2432 SSU ribosomal protein S2p (SAe) (Sphingobium sp. HT1-2) MATPVVTMQQLIEAGAHFGHQTHRWNPRMKPYIFGDRNGIHILDLSQTVPLFARALDFVS ATVAGGGKVLFVGTKRQAQDPIAEAARKSGQHFVNHRWLGGMLTNWKTISGSIKRLKTLE EKLSGDTHGFTKKEVLQMTREREKLELSLGGIRDMNGIPDVMFVIDANKEELAIKEANTL GIPVVAILDSNVSPDGIAFPVPANDDASRAIRLYCDAVAAAATKGNRGAQQASGIDLGAL DEPEAEEVVAQA