Protein Info for GFF243 in Sphingobium sp. HT1-2

Annotation: Quinolinate phosphoribosyltransferase [decarboxylating] (EC 2.4.2.19)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00078: nicotinate-nucleotide diphosphorylase (carboxylating)
  • amino acids 16 to 281 (266 residues), 271.6 bits, E=3.1e-85
• PF02749: QRPTase_N
  • amino acids 30 to 114 (85 residues), 64.2 bits, E=1e-21
• PF01729: QRPTase_C
  • amino acids 117 to 280 (164 residues), 171.5 bits, E=1.4e-54

Best Hits

Swiss-Prot: 52% identical to NADC_RHORU: Probable nicotinate-nucleotide pyrophosphorylase [carboxylating] (nadC) from Rhodospirillum rubrum

KEGG orthology group: K00767, nicotinate-nucleotide pyrophosphorylase (carboxylating) [EC: 2.4.2.19] (inferred from 92% identity to sjp:SJA_C1-28370)

Predicted SEED Role

"Quinolinate phosphoribosyltransferase [decarboxylating] (EC 2.4.2.19)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 2.4.2.19)

MetaCyc Pathways

• aspartate superpathway (25/25 steps found)
• NAD de novo biosynthesis I (6/6 steps found)
• NAD de novo biosynthesis III (6/6 steps found)
• NAD biosynthesis from 2-amino-3-carboxymuconate semialdehyde (4/4 steps found)
• NAD de novo biosynthesis IV (anaerobic) (5/6 steps found)
• NAD de novo biosynthesis II (from tryptophan) (5/9 steps found)
• superpathway of NAD biosynthesis in eukaryotes (7/14 steps found)
• nicotine biosynthesis (3/9 steps found)
• superpathway of nicotine biosynthesis (4/12 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Nicotinate and nicotinamide metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.19

Protein Sequence (284 amino acids)

>GFF243 Quinolinate phosphoribosyltransferase [decarboxylating] (EC 2.4.2.19) (Sphingobium sp. HT1-2)
VSAAFTLEGFDLDAFVASTLAEDLGPDGRDVTSEAVIPADAIFDGVMDSRDAVTLAGLPI
AVAFFRALDPDVEIALLHQDGDRVAAGTDIMRIRGKARALLTAERSALNTVQHLTGIATM
TRAYVDAILGTGAILLDTRKTIPGLRRLEKYATRMGGATNHRMGLWDAAMIKDNHVAVAG
SVEEAARRAVAAGIAQIIVEVDRVDQIEPALAAGATHLLLDNMDAPTLRGAVTLVSGRVP
TEASGGVTLETIRAKADTGVTYISVGRLTQSAPAADIGLDFSHA