Protein Info for GFF2429 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: TRAP-type C4-dicarboxylate transport system, large permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 426 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 47 to 66 (20 residues), see Phobius details amino acids 78 to 98 (21 residues), see Phobius details amino acids 104 to 125 (22 residues), see Phobius details amino acids 138 to 163 (26 residues), see Phobius details amino acids 170 to 192 (23 residues), see Phobius details amino acids 213 to 234 (22 residues), see Phobius details amino acids 240 to 256 (17 residues), see Phobius details amino acids 268 to 292 (25 residues), see Phobius details amino acids 312 to 329 (18 residues), see Phobius details amino acids 336 to 384 (49 residues), see Phobius details amino acids 396 to 417 (22 residues), see Phobius details PF06808: DctM" amino acids 8 to 416 (409 residues), 416 bits, see alignment E=1.7e-128 TIGR00786: TRAP transporter, DctM subunit" amino acids 17 to 419 (403 residues), 485.8 bits, see alignment E=4.5e-150

Best Hits

Swiss-Prot: 56% identical to YIAN_ECOLI: 2,3-diketo-L-gulonate TRAP transporter large permease protein YiaN (yiaN) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 84% identity to vpe:Varpa_0715)

MetaCyc: 56% identical to 2,3-diketo-L-gulonate:Na+ symporter - membrane subunit (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-235

Predicted SEED Role

"TRAP-type C4-dicarboxylate transport system, large permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (426 amino acids)

>GFF2429 TRAP-type C4-dicarboxylate transport system, large permease component (Hydrogenophaga sp. GW460-11-11-14-LB1)
MTVFVFIGSLLLTMALGMPIAYALLASGVALMWHLDLFDAQILAQNLIGGADSFPLLAVP
FFMLAGEIMNVGGLSRRIVNLALTVVGHVRGGLGYVTIMAGCLLSALSGSAVADAAALTA
LLLPMMTKAGHDRARAGGLIAATGVIGPVIPPSIGLVIFGVAANVSISKLFMAAIVPGLL
IGGALWVTWAWLVRRETIQPPPRKSGKEILKAARDAVWALVLPIIILVGLRMGIFTPTEA
AVVAAVYALFVATVVYRELSFKQLHEVFVVAAKTSAIVMFLIAAAMVSAWLITVADLPSK
VVDMLQPFMGNPILLMAAIMLLVMVVGTAMDMTPTILILTPVLMPVVKAAGIDPVYFGVM
FIINNSIGLVTPPVGTVLNVVAGVGRMKMDEVMRGVMPFMVAEFAVMFLMVLCPWLVTVP
AKWFSG