Protein Info for GFF2427 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Protein SseB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 PF07179: SseB" amino acids 2 to 109 (108 residues), 78.7 bits, see alignment E=4.4e-26 PF14581: SseB_C" amino acids 127 to 233 (107 residues), 99.7 bits, see alignment E=1e-32

Best Hits

Swiss-Prot: 91% identical to SSEB_SHIFL: Protein SseB (sseB) from Shigella flexneri

KEGG orthology group: None (inferred from 98% identity to seh:SeHA_C2797)

Predicted SEED Role

"Protein SseB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (248 amino acids)

>GFF2427 Protein SseB (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
LLEKAATEPAHRPAFFRTLLESTVWVPGSAAEGEAIVEDSALDLQHWEKEDGTTVIPFFT
SLEALQQAVEDEQAFVVMPARTLFEMTLGETLFLNAKLPTGKEFMPREISLLLAEEGSPL
STQEVLEGGESLILSEVAEPPSQMIDSLTTLFKTIKPVKRAFLCAIKEHADAQPNLLIGI
EADGEIEEIIHAAGNVATDTLPGDEPIDICQVRKGEQGISHFITEHIAPFYERRWGGFLR
DFKQNRII