Protein Info for GFF2426 in Sphingobium sp. HT1-2

Annotation: 1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC 1.1.1.267)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00243: 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  • amino acids 2 to 376 (375 residues), 456.5 bits, E=3.7e-141
• PF02670: DXP_reductoisom
  • amino acids 4 to 129 (126 residues), 122.9 bits, E=2.1e-39
• PF08436: DXP_redisom_C
  • amino acids 143 to 226 (84 residues), 133.5 bits, E=3.5e-43
• PF13288: DXPR_C
  • amino acids 258 to 373 (116 residues), 140.5 bits, E=4.5e-45

Best Hits

Swiss-Prot: 64% identical to DXR_ZYMMO: 1-deoxy-D-xylulose 5-phosphate reductoisomerase (dxr) from Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)

KEGG orthology group: K00099, 1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC: 1.1.1.267] (inferred from 86% identity to sjp:SJA_C1-24100)

Predicted SEED Role

"1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC 1.1.1.267)" in subsystem Isoprenoid Biosynthesis or polyprenyl synthesis (EC 1.1.1.267)

MetaCyc Pathways

• superpathway of geranylgeranyl diphosphate biosynthesis II (via MEP) (12/12 steps found)
• taxadiene biosynthesis (engineered) (12/13 steps found)
• methylerythritol phosphate pathway I (9/9 steps found)
• methylerythritol phosphate pathway II (9/9 steps found)
• isoprene biosynthesis I (9/10 steps found)
• superpathway of ergosterol biosynthesis II (11/26 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Terpenoid biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.267

Protein Sequence (385 amino acids)

>GFF2426 1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC 1.1.1.267) (Sphingobium sp. HT1-2)
MRSVSVFGATGSVGMSTLDLIQRDPDAYAVIALTANRDVAGLAAAARAVGAKIAVVADEA
QYGALKDALAGSGVEAAAGEGALVDAAAAGADWTMAAIVGCAGLKPTIAALQAGGTVALA
NKESLVSAGALMMQAATASGATLLPVDSEHNAIFQCLAGSSLDDVARIILTASGGPFRTL
GYEDMRAITPAQAVAHPNWSMGAKISVDSATMMNKGLELIEAAHLFPVGLDRIEILVHPQ
SVIHSMVEYRDRSTLAQLGSPDMRIPIAHALAWPARIATPCQPLDLARIGRLDFEAPDDR
RFPALRLARAAAQAGDASAAILNAANEVAVAAFLAGRIGFLDIAMIVEDVLNRYSAPMPA
CMDDVLHADATARVMAGDVMERLTV