Protein Info for GFF2425 in Variovorax sp. SCN45

Annotation: Putrescine transport ATP-binding protein PotA (TC 3.A.1.11.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 363 PF00005: ABC_tran" amino acids 21 to 161 (141 residues), 127.2 bits, see alignment E=7.3e-41 PF08402: TOBE_2" amino acids 278 to 353 (76 residues), 31.6 bits, see alignment E=1.4e-11

Best Hits

Swiss-Prot: 48% identical to POTA_RUBXD: Spermidine/putrescine import ATP-binding protein PotA (potA) from Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129)

KEGG orthology group: None (inferred from 75% identity to xtr:100486311)

Predicted SEED Role

"Putrescine transport ATP-binding protein PotA (TC 3.A.1.11.1)" in subsystem Polyamine Metabolism (TC 3.A.1.11.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (363 amino acids)

>GFF2425 Putrescine transport ATP-binding protein PotA (TC 3.A.1.11.1) (Variovorax sp. SCN45)
MPALTLDRLEKRYPGHVAASSVSLSVHDGEFISLLGPSGCGKTTVLRMVAGLIEPTGGRI
LVDGRDITALPTNRRNIGLVFQSYALFPHMSVFENVAFGLRRQGMQGSELKQRVDQALAS
VRLSALGDRMPKQLSGGQQQRVAVARSIAPRPSILLFDEPLSNLDASLRDEMQIELKRLQ
REVGITTLFVTHDQGEAMSMSDRVCVLAHGVVQQFDTPEAIYHRPATGFVASFIGRPNRL
TGRVVRANGASAAVQLDDGPMLPASAAEGMVQGAAVDVVIRQEDIRFADAPSPGAATLAG
RVAMRSFVGARVQYLLAFGGTELIAEAVTNGPHAGLEVDAPVRVAIAPQHVYVTARAAQA
ASA