Protein Info for GFF2424 in Sphingobium sp. HT1-2

Annotation: Outer membrane protein assembly factor YaeT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 881 signal peptide" amino acids 1 to 37 (37 residues), see Phobius details TIGR03303: outer membrane protein assembly complex, YaeT protein" amino acids 57 to 881 (825 residues), 732.6 bits, see alignment E=2.8e-224 PF07244: POTRA" amino acids 57 to 122 (66 residues), 27.3 bits, see alignment 7.2e-10 amino acids 124 to 201 (78 residues), 63.8 bits, see alignment E=3e-21 amino acids 205 to 292 (88 residues), 56.5 bits, see alignment E=5.5e-19 amino acids 295 to 371 (77 residues), 35.3 bits, see alignment E=2.3e-12 amino acids 377 to 451 (75 residues), 41.1 bits, see alignment E=3.7e-14 PF01103: Omp85" amino acids 478 to 881 (404 residues), 218.2 bits, see alignment E=3.2e-68

Best Hits

KEGG orthology group: K07277, outer membrane protein (inferred from 85% identity to sjp:SJA_C1-24080)

Predicted SEED Role

"Outer membrane protein assembly factor YaeT precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (881 amino acids)

>GFF2424 Outer membrane protein assembly factor YaeT (Sphingobium sp. HT1-2)
VTAMNSSKGQRPIIAALLATTMIAGLSAVPAMAQNAAPAAPAAAPIAASTANTPEGTIRS
ITVTGTQRLEQDTVMSYTKLRVGQAFSQESLDQALRDLYETELFADVQIRNDGGALTVEV
KENPVINRIVLEGNKRLKDDKIRPEIKLAPRQIYTRSKVRADVARIVELYRRQGRFAATI
EPKMVQLDQNRVDIVFEISEGPKSKVRQINIIGNEKFKDGELRGQMVTKQSRWFRIFSSG
TSYDPDRLAYDQQKLRQFYLTEGYADFRVISAVAELTPDKQDFIITYVVEEGDRYKFGDV
KVESDIRDLSGDALTRRLPMKKGDWYNAKQVEDTVDTLSETAGLFGYAFAQVEPDFNRSK
DDLTMGINFRIANAPRVYVERVDINGNTLTQDKVVRREFRLAEGDAFNSFLVKRSKDRIN
SLGFFQEKLDIEQKPGSAPDRIVLETNVQEKSTGELSLSAGYSSLERFIISASITQRNFR
GKGQELRTSVNYSAYSKSVEVGFTEPYFMDKNIALGGDIYRRDLNSFRYLSNNDRDTTYE
QTTTGFQLRAGVPITEYVSLALRYTLNFDDVTLDKDTYYTDGVCDPLLAGRYLCDAIGKR
TTSSIGYSLIYDTRDNRIRPTRGQTVTLSQDFAGLGGDVRYIRTRANAAKYWGLGGGFIF
SLTGEGGYIHSLQGTRYDATGAEVDPIRLTDRFFLGEPQMRGFDIRGVGPRVKRYYLVSQ
TNDDGSTSYVRQTGNNNVSDDALGGRVYYMARAEMEIPLGSGAREMGLRPSIFADVGAVA
GLKNPGTINFAGYCSDSTGSLSTVRATGTAASPVCPVGYDTKSGMFEEDYLGDTLKPRLS
VGFGVNWNSPFGPFRIDIAKALLKEPGDDNKLITFNVGTQF