Protein Info for GFF2423 in Variovorax sp. SCN45

Annotation: Spermidine Putrescine ABC transporter permease component potC (TC_3.A.1.11.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 263 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 67 to 90 (24 residues), see Phobius details amino acids 99 to 123 (25 residues), see Phobius details amino acids 134 to 153 (20 residues), see Phobius details amino acids 189 to 213 (25 residues), see Phobius details amino acids 234 to 253 (20 residues), see Phobius details PF00528: BPD_transp_1" amino acids 80 to 249 (170 residues), 42 bits, see alignment E=4.5e-15

Best Hits

KEGG orthology group: None (inferred from 84% identity to xtr:100486167)

Predicted SEED Role

"Spermidine Putrescine ABC transporter permease component potC (TC_3.A.1.11.1)" in subsystem Polyamine Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (263 amino acids)

>GFF2423 Spermidine Putrescine ABC transporter permease component potC (TC_3.A.1.11.1) (Variovorax sp. SCN45)
MNADGKKTPVLAATAIAVVVFLQIPVLVVVLAAFSKTAYLTIPPKGLTFHWFEVVLRDPE
YLGAAWTSLWLAAASTAAALVLGLIAAYAIHRRMVPGAAALTSLFMAPLILPSVVLGVAL
LQYYTMTGLRGNSLGLWLAHVVITVPYVVRASLGSLSSVDESLEDAARVLGADGFTSFRL
VTLPLVKPGLVAGGLFAFITSLDNVPVSVFLLSASQTTLPVKIFTSVEQGVDPSVAAVST
LLIVTTGIVLLLAERWTGFHKHV