Protein Info for GFF2420 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Penicillin-insensitive transglycosylase (EC 2.4.2.-) & transpeptidase PBP-1C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02073: penicillin-binding protein 1C
  • amino acids 37 to 768 (732 residues), 872.9 bits, E=1.1e-266
• PF00912: Transgly
  • amino acids 62 to 226 (165 residues), 178.5 bits, E=1.3e-56
• PF00905: Transpeptidase
  • amino acids 305 to 520 (216 residues), 45.3 bits, E=1.1e-15
• PF06832: BiPBP_C
  • amino acids 687 to 767 (81 residues), 55.1 bits, E=8.5e-19

Best Hits

Swiss-Prot: 82% identical to PBPC_ECOLI: Penicillin-binding protein 1C (pbpC) from Escherichia coli (strain K12)

KEGG orthology group: K05367, penicillin-binding protein 1C [EC: 2.4.1.-] (inferred from 83% identity to cko:CKO_00263)

MetaCyc: 82% identical to peptidoglycan glycosyltransferase PbpC (Escherichia coli K-12 substr. MG1655)
Peptidoglycan glycosyltransferase. [EC: 2.4.1.129]

Predicted SEED Role

"Penicillin-insensitive transglycosylase (EC 2.4.2.-) & transpeptidase PBP-1C" in subsystem Peptidoglycan Biosynthesis (EC 2.4.2.-)

MetaCyc Pathways

• peptidoglycan biosynthesis I (meso-diaminopimelate containing) (12/12 steps found)
• peptidoglycan biosynthesis III (mycobacteria) (11/15 steps found)
• peptidoglycan biosynthesis II (staphylococci) (12/17 steps found)
• peptidoglycan biosynthesis IV (Enterococcus faecium) (12/17 steps found)
• peptidoglycan biosynthesis V (β-lactam resistance) (11/17 steps found)
• peptidoglycan maturation (meso-diaminopimelate containing) (6/12 steps found)

KEGG Metabolic Maps

• Anthocyanin biosynthesis
• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Carotenoid biosynthesis - General
• Flavone and flavonol biosynthesis
• Flavonoid biosynthesis
• Fructose and mannose metabolism
• Glycerolipid metabolism
• Glycosphingolipid biosynthesis - ganglio series
• Glycosphingolipid biosynthesis - globo series
• Glycosphingolipid biosynthesis - lacto and neolacto series
• Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
• High-mannose type N-glycan biosynthesis
• Keratan sulfate biosynthesis
• Lipopolysaccharide biosynthesis
• N-Glycan biosynthesis
• O-Glycan biosynthesis
• O-Mannosyl glycan biosynthesis
• Peptidoglycan biosynthesis
• Purine metabolism
• Sphingolipid metabolism
• Zeatin biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-, 2.4.1.129, 2.4.2.-

Use Curated BLAST to search for 2.4.1.- or 2.4.1.129 or 2.4.2.-

Protein Sequence (771 amino acids)

>GFF2420 Penicillin-insensitive transglycosylase (EC 2.4.2.-) & transpeptidase PBP-1C (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MNGWRGKRGRWLWLAGAPLFIFLALWAADKLWPLPLNEVHPARVVVAHDGTPLWRFADAG
GIWRYPVTIEEVSPRYLEALINYEDRWFWRHPGVNPFSVARAAWQDLTAGRVISGGSTLT
MQVARLLDPHSRTFGGKIRQLWRALQLEWHLSKRDILTLYLNRAPFGGTLQGIGAASWAY
FGKPPARLSYADAALLAVLPQAPSRLRPDRWPARAEAARNKVLDRMAAQGVWPAETVRES
REEPVWLAPRQMPQLAPLFARMMLSKSQNDKIVTTLDAGLQRQLEDLARAWKGRLPARSS
LAMIVVDHTDMSVRGWVGSVDLNDDSRFGHVDMVTAIRSPGSVLKPFVYGLALDDGLIHP
ASLLQDVPRRTGDYRPGNFDSGFHGPVSMSDALVRSLNLPAVQVLEAYGPKRFAAKLRNV
GLPLYLPAGAAPNLSLILGGAGARLDEMAAAYSAFARHGKAAKLRLQPDDPLSERPLMSP
GAAWIIRRIMADEAQPLPDNALPRIVPLAWKTGTSYGYRDAWAIGVNARYIIGIWTGRPD
GTPVVGQFGFASAVPLLNQVNNLLLAHTGRLPEDPRPQAVSRGVICWPGGQTLPAGDSNC
RRRLATWLLDDSQPPTLLLPEQEDINGIRFPVWLDDTGRRVAADCPQARAHTFIVWPRPL
EPWLPPAERRSARLPAASDHCPPLQGNDAAPLMLSGVRDGAVIRQLPGQENVTLPVSTTG
GKGRRWWFLNGEPVNGENNRLSLLLNIAGRYQLVVMDESGQVAAVNFELIR