Protein Info for GFF2419 in Xanthobacter sp. DMC5

Annotation: Pantothenate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 323 TIGR00554: pantothenate kinase" amino acids 11 to 322 (312 residues), 428.7 bits, see alignment E=7.1e-133 PF00485: PRK" amino acids 96 to 252 (157 residues), 45.4 bits, see alignment E=4.4e-16

Best Hits

Swiss-Prot: 90% identical to COAA_XANP2: Pantothenate kinase (coaA) from Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)

KEGG orthology group: K00867, type I pantothenate kinase [EC: 2.7.1.33] (inferred from 90% identity to xau:Xaut_2287)

Predicted SEED Role

"Pantothenate kinase (EC 2.7.1.33)" in subsystem Coenzyme A Biosynthesis (EC 2.7.1.33)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.33

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (323 amino acids)

>GFF2419 Pantothenate kinase (Xanthobacter sp. DMC5)
MDRPIDPGLSPYRSFSREEWAKLRRDTPMTLRPDEIARLEGLGVRLSMKEVEEIYLPLSR
LLSLYVAATQKLYRAMSHFLDHREGEAAGEQKMPYIIGVAGSVAVGKSTTARVLQALLAR
WPNTPKVDLVTTDGFLLPNAILEREGLMEKKGFPESYDVALLLRFLTDIKAGRRPVRAPL
YSHFFYDVMPDQYVEIDRPDILIVEGLNVLQTTRPPKDGKAIPFVSDFFDFSVYIDGDED
VIERWYVERFMRLRETAFTDPLSYFHRYSQLSDDEAQATALSIWRRINLVNLQDNILPTR
QRADLILRKAGRHEIAEVSLRRL