Protein Info for GFF2416 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Putative polyferredoxin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 287 PF13187: Fer4_9" amino acids 25 to 67 (43 residues), 29.8 bits, see alignment 2.5e-10 amino acids 193 to 236 (44 residues), 32 bits, see alignment 5e-11 PF13237: Fer4_10" amino acids 25 to 63 (39 residues), 28 bits, see alignment 8.4e-10 amino acids 187 to 233 (47 residues), 34.4 bits, see alignment 8.2e-12 PF12838: Fer4_7" amino acids 25 to 66 (42 residues), 31.9 bits, see alignment 7.3e-11 amino acids 193 to 236 (44 residues), 37.4 bits, see alignment 1.5e-12 PF25160: LdpA_Fe-S-bd" amino acids 27 to 68 (42 residues), 31.8 bits, see alignment 4.9e-11 PF12837: Fer4_6" amino acids 45 to 67 (23 residues), 25.7 bits, see alignment (E = 4.1e-09) amino acids 216 to 237 (22 residues), 27.4 bits, see alignment (E = 1.2e-09) PF00037: Fer4" amino acids 46 to 68 (23 residues), 29.8 bits, see alignment (E = 1.9e-10) amino acids 187 to 209 (23 residues), 21.5 bits, see alignment (E = 7.9e-08) amino acids 219 to 237 (19 residues), 25 bits, see alignment (E = 6.4e-09) PF14697: Fer4_21" amino acids 188 to 238 (51 residues), 35.3 bits, see alignment 5.2e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to stm:STM2527)

Predicted SEED Role

"Putative polyferredoxin"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (287 amino acids)

>GFF2416 Putative polyferredoxin (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MVNLTIDPAVDVTQACVRRRFRFSSCRACADVCPAQAFSLAQGQVSIDTTRCIACGDCLF
VCPVDAITGIKPVKRFVQGDTLVGPFSLQAPTVDELLLWHSQYGIRFIDIAVERSAQWLM
ALARLNLALRRYGEPGWSFKHVVGAEINASRRTLFHVPRDAITPCAVEPGKRRLRQAFSA
FSECVPEISPQECRMCGACWRSCPENVIQFDDNTLTIAAARCTGCGGCAAVCPHQALRLR
FDVEPASTRHSTAYTLTCDICKRTFHALTPEHTHCVLCQSPEFAVRL