Protein Info for GFF2415 in Xanthobacter sp. DMC5

Annotation: Imidazole glycerol phosphate synthase subunit HisH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 218 TIGR01855: imidazole glycerol phosphate synthase, glutamine amidotransferase subunit" amino acids 3 to 215 (213 residues), 209 bits, see alignment E=3.2e-66 PF00117: GATase" amino acids 13 to 214 (202 residues), 72 bits, see alignment E=5.4e-24

Best Hits

Swiss-Prot: 66% identical to HIS51_NITWN: Imidazole glycerol phosphate synthase subunit HisH 1 (hisH1) from Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)

KEGG orthology group: K02501, glutamine amidotransferase [EC: 2.4.2.-] (inferred from 88% identity to xau:Xaut_2291)

Predicted SEED Role

"Imidazole glycerol phosphate synthase amidotransferase subunit (EC 2.4.2.-)" in subsystem Histidine Biosynthesis (EC 2.4.2.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.2.-

Use Curated BLAST to search for 2.4.2.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (218 amino acids)

>GFF2415 Imidazole glycerol phosphate synthase subunit HisH (Xanthobacter sp. DMC5)
VTVAIIDYNSGNLHSAAKAMERAAQSLAHDAGQTVIVTSDPEVVRTADRVVLPGVGAFAD
CRAGLDAVPGMVEAMTEAVKGRGRPFLGICVGLQLLAERGLEHGVTEGLGWIRGEVDRIT
PNDPSLKIPHMGWNTLEIAREHPLLAGIPTGASGLHAYFVHSYHLKPADGIDLLATTDYG
GTITAAVARDNVAGTQFHPEKSQTLGLALLANFLKWHP