Protein Info for PS417_12265 in Pseudomonas simiae WCS417

Annotation: ACP phosphodiesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03358: FMN_red
  • amino acids 6 to 150 (145 residues), 133.3 bits, E=5.4e-43
• PF02525: Flavodoxin_2
  • amino acids 7 to 97 (91 residues), 29.1 bits, E=7.7e-11

Best Hits

Swiss-Prot: 72% identical to CHRR_PSEPU: Quinone reductase (chrR) from Pseudomonas putida

KEGG orthology group: None (inferred from 97% identity to pfs:PFLU2652)

MetaCyc: 73% identical to quinone reductase (Pseudomonas putida KT2440)
RXN0-5330 [EC: 1.6.5.9]

Predicted SEED Role

"FMN reductase, NADPH-dependent"

MetaCyc Pathways

• superpathway of NAD/NADP - NADH/NADPH interconversion (yeast) (7/8 steps found)
• NADH to cytochrome bo oxidase electron transfer II (2/2 steps found)
• NADH to nitrate electron transfer (2/2 steps found)
• mitochondrial NADPH production (yeast) (4/5 steps found)
• aerobic respiration II (cytochrome c) (yeast) (3/4 steps found)
• NADH to cytochrome aa₃ oxidase electron transfer (1/2 steps found)
• NADH to cytochrome bd oxidase electron transfer II (1/2 steps found)
• nitrate reduction VIIIb (dissimilatory) (1/2 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.6.5.9

Sequence Analysis Tools

See A0A1N7TX70 at UniProt or InterPro

Protein Sequence (185 amino acids)

>PS417_12265 ACP phosphodiesterase (Pseudomonas simiae WCS417)
MSKVYTVAVVVGSLRKDSINRKVALALAELAPANLQLNIVEIGDLPLYNEDIDGATPPAA
YSTFRRQVSSSDAVLFVTPEYNRSVPAPLKNAIDVGSRPYGQSAWSGKPGAVISVSPGAI
GGFGANHHLRQSLVFLDVPCMQQPEAYLGGAGSVFDEAGKVSEKTKPFLQAFIDAYSKWV
AKQHA