Protein Info for GFF2404 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 499 transmembrane" amino acids 15 to 39 (25 residues), see Phobius details amino acids 45 to 70 (26 residues), see Phobius details amino acids 108 to 132 (25 residues), see Phobius details amino acids 150 to 181 (32 residues), see Phobius details amino acids 203 to 220 (18 residues), see Phobius details amino acids 254 to 279 (26 residues), see Phobius details amino acids 319 to 342 (24 residues), see Phobius details amino acids 354 to 376 (23 residues), see Phobius details amino acids 386 to 405 (20 residues), see Phobius details amino acids 411 to 429 (19 residues), see Phobius details amino acids 433 to 450 (18 residues), see Phobius details amino acids 466 to 489 (24 residues), see Phobius details PF01970: TctA" amino acids 20 to 438 (419 residues), 557.5 bits, see alignment E=8.7e-172

Best Hits

Swiss-Prot: 68% identical to YZ2R_AGRVI: Uncharacterized 52.8 kDa protein in TAR-I ttuC' 3'region from Agrobacterium vitis

KEGG orthology group: None (inferred from 93% identity to xau:Xaut_1332)

Predicted SEED Role

"Tricarboxylate transport membrane protein TctA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (499 amino acids)

>GFF2404 hypothetical protein (Xanthobacter sp. DMC5)
VDLLDNLALGFSVALSLQNIFYCFVGALLGTLIGVLPGLGPVATIAMLLPLTFGLPPVSA
LIMLAGIYYGAQYGGSTTAILINLPGESSSVVTAIDGHQMARKGRAGAALATAALGSFFA
GSVATLLLALFAPPLANLALQFGPPEYFSLMVLGLIASVTLASGSVVKAIAMIVLGLILG
LSGQDIYTGTPRFTFDLPELSDGFDFVALAMGMFGISEIIRNLEDEHQRSLVAAKVKSLM
LTKEEFKRIIAPVLRGTALGSFLGILPGGGAMLSSFASYSIEKKLSRHPQEFGRGAIEGV
AGPESANNAGAQTSFIPMLTLGIPSNPVMALMIGALIIQGITPGPNVVTEKPDLFWGVIA
SMWVGNFMLVLLNLPLIGMWVKLLTVPYHVMFPAIIAFCCIGVYSVNNNVFDVYTMALFG
LLGYALVKLDCEPAPLLLGFVIGPMLEEYLRRAMLISRGDPTVFVTRPISAVLLLLALAA
LVVVLLPSVQKGREEAFKE