Protein Info for GFF2404 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Tricarboxylate transport protein TctC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF03401: TctC" amino acids 48 to 323 (276 residues), 263.3 bits, see alignment E=1.5e-82

Best Hits

Swiss-Prot: 39% identical to YTCB_PSESQ: UPF0065 protein in tcbD-tcbE intergenic region from Pseudomonas sp. (strain P51)

KEGG orthology group: None (inferred from 70% identity to reh:H16_B0088)

Predicted SEED Role

"Tricarboxylate transport protein TctC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (327 amino acids)

>GFF2404 Tricarboxylate transport protein TctC (Hydrogenophaga sp. GW460-11-11-14-LB1)
MHTLSRRSFAFYAGCAALGLAHAQTPFPGKPVTLVVPYAPGGPTDAMARTLATALRPALG
TTQPVIVENKAGAGANIGAEFVARAEPDGHTILFGTSAPLAINVSLYSKIGYDPVRSFAP
VIHLGYLPNVLVVHPSVPAKNVQELIAHAKAQGNKLSYASSGSGASSHLAGVLFNQRAGT
DIQHIPYKGTGPALNDLLGGQVAMAFTDVLTALPHIKAGKLRALGLTTAARSRSLPDVPT
VMEQGVPNYDVSVFFGIVAPAGTPDEVVQRLNAAFVSVLKQPDVHQRLQEQGLEITTDQR
PAQLATFIQSEVNKWRDVVKASGARAD