Protein Info for PS417_12235 in Pseudomonas simiae WCS417

Annotation: DNA polymerase III subunit epsilon

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 TIGR01406: DNA polymerase III, epsilon subunit" amino acids 4 to 243 (240 residues), 295.9 bits, see alignment E=2.1e-92 TIGR00573: exonuclease, DNA polymerase III, epsilon subunit family" amino acids 5 to 224 (220 residues), 215.4 bits, see alignment E=6.8e-68 PF00929: RNase_T" amino acids 6 to 169 (164 residues), 136.1 bits, see alignment E=8.5e-44

Best Hits

KEGG orthology group: K02342, DNA polymerase III subunit epsilon [EC: 2.7.7.7] (inferred from 98% identity to pfs:PFLU2646)

Predicted SEED Role

"DNA polymerase III epsilon subunit (EC 2.7.7.7)" in subsystem DNA-replication (EC 2.7.7.7)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.7

Use Curated BLAST to search for 2.7.7.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U8Z4 at UniProt or InterPro

Protein Sequence (248 amino acids)

>PS417_12235 DNA polymerase III subunit epsilon (Pseudomonas simiae WCS417)
MAIRSVVLDTETTGMPVTDGHRIIEIGCVELMGRRLTGRHFHVYLQPDRDSDEGAIGVHG
ITDEFLKGKPRFAEVADEFFEFINGAQLIIHNAAFDVGFINNEFALMGQTDRADISQHCS
ILDTLMMARERHPGQRNSLDALCKRYGVDNSGRELHGALLDSEILADVYLTMTGGQTSLS
LAGNASDGSGSAEGSGNRPSEIRRLPADRKPTTIIRASEQDLAEHAARLEAIAKSAGAPA
LWSTLTQQ