Protein Info for PS417_01215 in Pseudomonas simiae WCS417

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 283 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 30 to 52 (23 residues), see Phobius details amino acids 58 to 79 (22 residues), see Phobius details amino acids 88 to 108 (21 residues), see Phobius details amino acids 114 to 134 (21 residues), see Phobius details amino acids 146 to 165 (20 residues), see Phobius details amino acids 176 to 197 (22 residues), see Phobius details amino acids 209 to 230 (22 residues), see Phobius details amino acids 235 to 257 (23 residues), see Phobius details amino acids 263 to 282 (20 residues), see Phobius details PF00892: EamA" amino acids 2 to 132 (131 residues), 31.3 bits, see alignment E=1.2e-11 amino acids 147 to 279 (133 residues), 51.8 bits, see alignment E=5.5e-18

Best Hits

KEGG orthology group: None (inferred from 76% identity to pfl:PFL_0285)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TVD1 at UniProt or InterPro

Protein Sequence (283 amino acids)

>PS417_01215 membrane protein (Pseudomonas simiae WCS417)
MGLLAALLWGGTDFLVGLNARAVGVKRAVYFGQALGFLIMTLLLVILPSLLFKSLEAALS
VWLLGIAAALLTVSGALALSKAFALGKAAIVAPLVTSYGVVTTLLSWASGEHISLTQLGC
IALCVIGVILSSLHKDNGVPHNNPRLSIAYAMLAALLYGTSFWLQGRYTLPALGPITMLW
LGYLVGLCVLVMMVLKITDGLKIPPLKNCATLTGASLMNLGGFSAFSWGAMAGSVSVVTV
ISTLSGGIAAILGFVFFKERLSAVQVLGVVLVLVGAVVLHIVD