Protein Info for GFF24 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Hydroxymethylpyrimidine ABC transporter, transmembrane component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 252 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 63 to 82 (20 residues), see Phobius details amino acids 95 to 117 (23 residues), see Phobius details amino acids 122 to 139 (18 residues), see Phobius details amino acids 171 to 196 (26 residues), see Phobius details amino acids 215 to 238 (24 residues), see Phobius details PF00528: BPD_transp_1" amino acids 74 to 242 (169 residues), 89.1 bits, see alignment E=1.6e-29

Best Hits

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 32% identity to rop:ROP_50120)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (252 amino acids)

>GFF24 Hydroxymethylpyrimidine ABC transporter, transmembrane component (Hydrogenophaga sp. GW460-11-11-14-LB1)
MRLDRSHLTKAAGVVLFLAAWQAGATLGNTRMLPGIPDVARQLAEMIQSGELFEHALSTL
SKGFLGLALALVAGAAVGILCARHRYTDAALHPVISMLYPVPKLALYPVVVLIFGFGGAS
KIVQVGLECFFPIFVQMYAGTRAVPRNLLWLAENNEVGPLRMVRDVLLPSLLPYLLTGLR
VATPIMLIVMCVTEFIGESKGLGYLISRYSSYFDTASAFAVIVVLGLFGLVADRLIVYLR
TRAVFWERGVSL