Protein Info for GFF2398 in Xanthobacter sp. DMC5

Annotation: Pyridoxal kinase PdxY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00687: pyridoxal kinase
  • amino acids 2 to 279 (278 residues), 352.6 bits, E=8.7e-110
• PF08543: Phos_pyr_kin
  • amino acids 90 to 253 (164 residues), 63.9 bits, E=1.5e-21
• PF00294: PfkB
  • amino acids 132 to 243 (112 residues), 37.4 bits, E=1.9e-13

Best Hits

Swiss-Prot: 65% identical to PDXY_GRABC: Pyridoxal kinase PdxY (pdxY) from Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)

KEGG orthology group: K00868, pyridoxine kinase [EC: 2.7.1.35] (inferred from 89% identity to xau:Xaut_1325)

Predicted SEED Role

"Pyridoxal kinase (EC 2.7.1.35)" in subsystem Pyridoxin (Vitamin B6) Biosynthesis (EC 2.7.1.35)

MetaCyc Pathways

• pyridoxal 5'-phosphate salvage II (plants) (9/9 steps found)
• superpathway of pyridoxal 5'-phosphate biosynthesis and salvage (11/12 steps found)
• pyridoxal 5'-phosphate salvage I (6/6 steps found)
• 4-amino-2-methyl-5-diphosphomethylpyrimidine biosynthesis II (5/8 steps found)

KEGG Metabolic Maps

• Vitamin B6 metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.35

Protein Sequence (282 amino acids)

>GFF2398 Pyridoxal kinase PdxY (Xanthobacter sp. DMC5)
MNILSIQSHVAYGHVGNASAVFPLQRLGVEVWPINTVQFSNHTGYGAWRGQVFEASVIGD
LVEGIAERGVLSRCDGVLSGYMGSADIGAAILDAVERVRAANRNAAYCCDPVIGDVGRGI
FVRPGIPEFMREKAVPAADVITPNQFELELLTGRTCTTLPEAIAACDALHALGPKVILVT
SLHVGETPPDSIDLLASGPDGRFLVRTPRLALSLNGAGDAIAALFFFHVLRTGSTAQAVS
LAASSIYGVLSRTEKAQSRELLLVEAQEEFVTPSRLFPASAI