Protein Info for GFF2394 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Phosphate regulon sensor protein PhoR (SphS) (EC 2.7.13.3)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 608 transmembrane" amino acids 169 to 189 (21 residues), see Phobius details amino acids 200 to 219 (20 residues), see Phobius details amino acids 231 to 252 (22 residues), see Phobius details amino acids 264 to 287 (24 residues), see Phobius details amino acids 293 to 312 (20 residues), see Phobius details amino acids 319 to 337 (19 residues), see Phobius details amino acids 351 to 370 (20 residues), see Phobius details PF07696: 7TMR-DISMED2" amino acids 28 to 156 (129 residues), 90.4 bits, see alignment E=2e-29 PF07695: 7TMR-DISM_7TM" amino acids 167 to 371 (205 residues), 85 bits, see alignment E=1.4e-27 PF00512: HisKA" amino acids 389 to 454 (66 residues), 39.2 bits, see alignment E=1.2e-13 PF02518: HATPase_c" amino acids 496 to 603 (108 residues), 74.4 bits, see alignment E=2e-24

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (608 amino acids)

>GFF2394 Phosphate regulon sensor protein PhoR (SphS) (EC 2.7.13.3) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MFLFCGIAHAQPPVVLDRSVGMIPLHGRMAWLIDAGGRLRVQEAETAAGWQALPGSPNAG
FTSDAIWLRFEVIQATNAPSWRLELRNTLLEDVRFFQRDAAGEWHMQVAGRNVKRSAWPL
DTRSPAFRLDLPPGRHEVMVRLASRNSLSTGLRLWEAELFYASARDEALLWGGYFGLYGL
VILIQFLFWQWTREALSGWYVPYAALNFLGVLMTMGYLQNALDWNSDLATPILGISICAV
VFVSTRFSSVLLGLDQVMPRLNRFLLRGAAAVSVGTSLLVIAGQYAAGVGTSQVVSMAWI
MLLSGASIVLVWRGHAPARFYLIAFAIFYLGVLIRYLRNLGWLEPGLVTDYSIQVGSVLH
MIVMCLFIVYRYNALRIALRVEQAARQEQRDFVAMVSHELRTPLAIIGASAQQLAAHLDA
PVEKSLRRCTNITAASRRMAELMDNYLTAERMDSSERSIRIRRCAMPSFFKELVSEWPED
RIKLTTKALPEDYACDLDMLQVAFRNLITNAIRHSRASTVIDVMVRGNGQGGLTVRVVNR
GENIPLEERPFLFQKYYRGRAARGKTGAGLGLFLVKRIIDAHGGRVEVQCDSGVTTFKVL
LPALASSD