Protein Info for PS417_12200 in Pseudomonas simiae WCS417

Annotation: microcin ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 358 signal peptide" amino acids 7 to 11 (5 residues), see Phobius details amino acids 28 to 30 (3 residues), see Phobius details transmembrane" amino acids 12 to 27 (16 residues), see Phobius details amino acids 129 to 148 (20 residues), see Phobius details amino acids 161 to 188 (28 residues), see Phobius details amino acids 216 to 238 (23 residues), see Phobius details amino acids 274 to 301 (28 residues), see Phobius details amino acids 321 to 340 (20 residues), see Phobius details PF00528: BPD_transp_1" amino acids 144 to 351 (208 residues), 121.4 bits, see alignment E=1.9e-39

Best Hits

Swiss-Prot: 63% identical to YEJB_ECOLI: Inner membrane ABC transporter permease protein YejB (yejB) from Escherichia coli (strain K12)

KEGG orthology group: K13894, microcin C transport system permease protein (inferred from 99% identity to pfs:PFLU2638)

MetaCyc: 63% identical to putative oligopeptide ABC transporter membrane subunit YejB (Escherichia coli K-12 substr. MG1655)
3.6.3.23-RXN [EC: 7.4.2.6]

Predicted SEED Role

"Oligopeptide transport system permease protein OppB (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U162 at UniProt or InterPro

Protein Sequence (358 amino acids)

>PS417_12200 microcin ABC transporter permease (Pseudomonas simiae WCS417)
MLAYIFRRLLLIIPTLFGILLINFVIIQAAPGGPVEQMIAKLEGFEGATSRIAGGGAEVS
VAGSSSYRGAQGLDPALIKEIEKMYGFDKSAPERLWIMVKNYAQLDFGDSFFRDAKVIDL
IKEKMPVSISLGLWSTLIMYLVSIPLGIAKATRHGSHFDVWTSSAIIVGYAIPAFLFAIL
LIVVFAGGSYLDWFPLRGLTSNNFDELSWGGKILDYFWHLALPITALVIGNFATMTLLTK
NSFLDEINKQYVVTAKAKGLTNHRVLYGHIFRNAMLLVIAGFPSAFIGIFFTGSLLVEVI
FSLDGLGLMSFEAAINRDYPVVFGTLFIFTLLGLIVKLIGDLTYTLVDPRIDFASREH