Protein Info for GFF2387 in Xanthobacter sp. DMC5

Annotation: Phosphoadenosine phosphosulfate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 236 TIGR00434: phosophoadenylyl-sulfate reductase" amino acids 27 to 231 (205 residues), 174.7 bits, see alignment E=1.3e-55 PF01507: PAPS_reduct" amino acids 40 to 207 (168 residues), 136.6 bits, see alignment E=4.8e-44

Best Hits

Swiss-Prot: 55% identical to CYSH_RHILO: Phosphoadenosine phosphosulfate reductase (cysH) from Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)

KEGG orthology group: K00390, phosphoadenosine phosphosulfate reductase [EC: 1.8.4.8] (inferred from 80% identity to xau:Xaut_1395)

Predicted SEED Role

"Phosphoadenylyl-sulfate reductase [thioredoxin] (EC 1.8.4.8) / Adenylyl-sulfate reductase [thioredoxin] (EC 1.8.4.10)" in subsystem Cysteine Biosynthesis (EC 1.8.4.10, EC 1.8.4.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.4.10 or 1.8.4.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (236 amino acids)

>GFF2387 Phosphoadenosine phosphosulfate reductase (Xanthobacter sp. DMC5)
MNALERAAPRLDLDALNARLENASPLDVIAAGLAAFPGRIAAVSSFGTESAVLLHMIAQV
DSATPILFLDTGHLFEETLAYRDTLAGHLGLTNVQTFSPDPAALAARDPERGLWSDNADA
CCALRKVEPLARALAPYGAWFNGRKRYQAATRTAIALVEQDGERVKFNPLAAMGRDELVG
YMDAHGLPRHPLEKHGFASIGCMPCTSRVQPGEDPRAGRWRGKAKTECGIHFGDGI