Protein Info for PS417_12160 in Pseudomonas simiae WCS417

Annotation: Fis family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 469 PF00989: PAS" amino acids 23 to 116 (94 residues), 28.4 bits, see alignment E=6.6e-10 PF13188: PAS_8" amino acids 24 to 68 (45 residues), 24.4 bits, see alignment 9.1e-09 PF08448: PAS_4" amino acids 26 to 116 (91 residues), 26.6 bits, see alignment E=2.7e-09 PF00158: Sigma54_activat" amino acids 159 to 326 (168 residues), 222.5 bits, see alignment E=1.2e-69 PF14532: Sigma54_activ_2" amino acids 159 to 330 (172 residues), 69.7 bits, see alignment E=1.5e-22 PF01078: Mg_chelatase" amino acids 170 to 271 (102 residues), 21 bits, see alignment E=8.9e-08 PF07728: AAA_5" amino acids 181 to 299 (119 residues), 30.1 bits, see alignment E=2e-10 PF25601: AAA_lid_14" amino acids 331 to 403 (73 residues), 66 bits, see alignment E=9.9e-22 PF02954: HTH_8" amino acids 423 to 460 (38 residues), 46.4 bits, see alignment 1.1e-15

Best Hits

KEGG orthology group: None (inferred from 97% identity to pfs:PFLU2630)

Predicted SEED Role

"Sigma-54 dependent transcriptional regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UKD2 at UniProt or InterPro

Protein Sequence (469 amino acids)

>PS417_12160 Fis family transcriptional regulator (Pseudomonas simiae WCS417)
MNITDNLKDYQQVRGLAIQSLFEIIEQSSEGTVIVDRDANIVWMNERYAKRFGLKSADEA
IGQPCEQVISNSLLRQVVRNDQPILLDIQDTPKGPLVVMRLPIHNEAGAVIGAIGFALFD
ELRNLSPLIERYLSMQQELASTRSLLRSRQSKYNFAHFIGTSAASLEVKRRARRSASAES
PVLLLGETGTGKELLAQAIHGASSRAHKAFVSINSAAIPADLLEAEFFGTAPGAFTGADR
KGRPGKFQIAQGGTLFLDEIGDMPLPLQSKLLRVLQEKEFEPVGSNEMLHSDVRVIAATS
MDLEAAIKRGEFRADLYYRLNVLPIQVPPLRERLEDIPALSEAILEELRSQHELDREALA
LLAQHAWPGNIRELRNVLERAALLSDDLVLDAREIRAAIGTFTPVERASAVAAVEGESFS
AARERFDRQVIGAALRACEGNVIEAANRLGLGRSTLYKKMVALDLTQSQ