Protein Info for GFF2380 in Sphingobium sp. HT1-2

Annotation: UPF0246 protein YaaA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 PF03883: H2O2_YaaD" amino acids 13 to 250 (238 residues), 254 bits, see alignment E=7e-80

Best Hits

Swiss-Prot: 61% identical to Y4565_SPHWW: UPF0246 protein Swit_4565 (Swit_4565) from Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273)

KEGG orthology group: K09861, hypothetical protein (inferred from 84% identity to sjp:SJA_C2-05400)

Predicted SEED Role

"UPF0246 protein YaaA" in subsystem YaaA

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (262 amino acids)

>GFF2380 UPF0246 protein YaaA (Sphingobium sp. HT1-2)
LTPGRGAATARGMIVLLSPAKTLDFERALPPLAVTTPHFAEEARGLAKSAANLSQKRLAE
LMHISPRLAKLNADRFRDFAELPERQALYAFAGDVYSGFEVDTLDEEAVAFAQDHVRMLS
GLYGLLRPLDAIRPYRLEMGTRWAPRHKKLTDWWGDRIAALLRAQAAEEGSGVVLNLASQ
EYFAAVENRLDGLRVIHVDFREPGPNGPRFVSFNAKRARGMMARWMCEHHVADVEAMHGF
DSDGYRLDPAESDADHWRFMRA