Protein Info for GFF238 in Sphingobium sp. HT1-2

Annotation: putative carboxylesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 473 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF00135: COesterase" amino acids 33 to 347 (315 residues), 289.6 bits, see alignment E=8.6e-90 amino acids 356 to 460 (105 residues), 62.6 bits, see alignment E=5.7e-21 PF20434: BD-FAE" amino acids 116 to 225 (110 residues), 41.9 bits, see alignment E=1.2e-14 PF07859: Abhydrolase_3" amino acids 192 to 237 (46 residues), 25.8 bits, see alignment 1.3e-09

Best Hits

KEGG orthology group: K03927, carboxylesterase type B [EC: 3.1.1.1] (inferred from 60% identity to sch:Sphch_3340)

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.1

Use Curated BLAST to search for 3.1.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (473 amino acids)

>GFF238 putative carboxylesterase (Sphingobium sp. HT1-2)
MQRTTIIGLGALLLGTSALGTAPLAARSPTPQPQMVQTEAGIVHGALDAGVESWKGIPFA
APPVGDLRWRMPQPAARWQGVREATAYRNDCMQLPFPSDAAPLGTPPAEDCLYANVWKPA
GATAKLPVLFWIYGGGFVNGGSSPPTYAGAALAKQGLMVVSFNYRLGRFGTFAHPALAAA
NEDKGLAGNYGLMDQVAALQWVKRNIARFGGDPANITIIGESAGGMSVHALLTSPLSQGL
FQRAVIMSGGDGQMMGPKDGSAATIGEAFAATKGIKGSDAAALKGLRALPADQVIDGLNL
EGMFKGQLGPYSPPFPDGKIAVNPAAAYAAGNFAHVPVMVGATSADIGGPTGFMVGGART
VAATLAAAKLPVYAYRFDYVATSVGKPGAGHATDIPYFFDTQAIKYGAATTARDNDMGRT
ISAYIVNFARSGDPNGTGLAAWPRYDATQDRIMLFNPDGKAAAQKDPLPPVTP