Protein Info for GFF2375 in Xanthobacter sp. DMC5

Annotation: Beta-barrel assembly-enhancing protease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 579 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details PF13181: TPR_8" amino acids 309 to 329 (21 residues), 13.3 bits, see alignment (E = 5.6e-05) amino acids 485 to 511 (27 residues), 16.8 bits, see alignment (E = 4.3e-06) PF13432: TPR_16" amino acids 460 to 513 (54 residues), 17.2 bits, see alignment 4.1e-06 amino acids 485 to 536 (52 residues), 17.5 bits, see alignment 3.2e-06 PF07719: TPR_2" amino acids 485 to 512 (28 residues), 27.2 bits, see alignment (E = 1.9e-09) PF13174: TPR_6" amino acids 485 to 508 (24 residues), 14.1 bits, see alignment (E = 4.5e-05) PF13414: TPR_11" amino acids 488 to 527 (40 residues), 35.3 bits, see alignment 5.3e-12

Best Hits

KEGG orthology group: None (inferred from 89% identity to xau:Xaut_1382)

Predicted SEED Role

"TPR repeat precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (579 amino acids)

>GFF2375 Beta-barrel assembly-enhancing protease (Xanthobacter sp. DMC5)
VTTRRPTFSAALAAGLAAVLTLSPGLARAEAVPDFDTSLAGNYLAARLASTERDQDAAVV
YLRNLMKLDARNEEILERTFFAMLMDGQIDDAMKLADRLVKIDRTHRVARLALAVRSIKK
GHYQTARTNLALSVRGPIGDLTATLLAAWTFFGSGNTKGAVELIDRLDGPDWYAPMKELH
AGLILDAAGQKKEAGRRLEAAMKADPGSLRAIDAYARWASRNDNTEAALAAYAAFDKQLP
NHPIVLAAIKELKAGKQLPPLVKTAQEGSSEVLYGLGATLGRQGGEDLALVYLQLAIWLY
PEHPFASLTLADLYEQLKQPAKAIEVYETVPDSSPLKRNAQVQLAVNLDATDHYKEARAQ
LEKMIAADPKDIEAIIALGKIQQTRKMFSECAGTYSKAIALIPQPTRGNWALFYFRGVCN
ERSKNWPAAEADLKKALELNPDQPHVLNYLGYSWVDQGTNLDQGLDMIRKAAKLRPDDGP
IVDSLGWAYYRLGRYDDAVVQLERAIELMPQDPVINDHLGDAYWKVGRKLEAGFQWNHAR
DLKPEPDDLAKIVQKINKGLDSVDQPAPVRKAEEQQKGG