Protein Info for PS417_12105 in Pseudomonas simiae WCS417

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 220 transmembrane" amino acids 25 to 49 (25 residues), see Phobius details amino acids 61 to 82 (22 residues), see Phobius details amino acids 88 to 107 (20 residues), see Phobius details amino acids 127 to 145 (19 residues), see Phobius details amino acids 159 to 177 (19 residues), see Phobius details amino acids 189 to 210 (22 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 16 to 112 (97 residues), 80.2 bits, see alignment E=6.6e-27 PF00528: BPD_transp_1" amino acids 36 to 217 (182 residues), 81.8 bits, see alignment E=2.8e-27

Best Hits

Swiss-Prot: 32% identical to ARTQ_BACSU: Arginine transport system permease protein ArtQ (artQ) from Bacillus subtilis (strain 168)

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 98% identity to pfs:PFLU2619)

Predicted SEED Role

"Amino acid ABC transporter, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UEK7 at UniProt or InterPro

Protein Sequence (220 amino acids)

>PS417_12105 ABC transporter permease (Pseudomonas simiae WCS417)
MYESPSWLHELWIARETLWAGFQASVYVSALAIIFGTLIGIVAGLILTYGKFWMRAPFRL
YVDLIRGTPVFVLVLACFYMLPALGWQITAFQAGAVGLTLFCGSHVSEIVRGALQAIPRG
QLEAGKAIGLTFYQSLGYVLLPQALRQILPTWVNSSTEIVKASTLLSVIGVAELLLSTQQ
VIARTFMTLEFYLFAGFMFFVINYAIELFGRYIEKRVALP