Protein Info for GFF2372 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 917 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 138 to 158 (21 residues), see Phobius details amino acids 166 to 187 (22 residues), see Phobius details amino acids 209 to 229 (21 residues), see Phobius details amino acids 235 to 256 (22 residues), see Phobius details amino acids 261 to 278 (18 residues), see Phobius details amino acids 284 to 302 (19 residues), see Phobius details amino acids 309 to 328 (20 residues), see Phobius details amino acids 334 to 357 (24 residues), see Phobius details amino acids 369 to 386 (18 residues), see Phobius details amino acids 392 to 410 (19 residues), see Phobius details amino acids 417 to 435 (19 residues), see Phobius details amino acids 461 to 482 (22 residues), see Phobius details amino acids 492 to 514 (23 residues), see Phobius details amino acids 520 to 538 (19 residues), see Phobius details amino acids 549 to 567 (19 residues), see Phobius details amino acids 573 to 591 (19 residues), see Phobius details amino acids 600 to 618 (19 residues), see Phobius details amino acids 630 to 650 (21 residues), see Phobius details amino acids 662 to 681 (20 residues), see Phobius details amino acids 688 to 709 (22 residues), see Phobius details amino acids 721 to 742 (22 residues), see Phobius details amino acids 761 to 778 (18 residues), see Phobius details amino acids 789 to 810 (22 residues), see Phobius details amino acids 825 to 844 (20 residues), see Phobius details amino acids 851 to 868 (18 residues), see Phobius details amino acids 880 to 897 (18 residues), see Phobius details PF10101: DUF2339" amino acids 135 to 900 (766 residues), 415 bits, see alignment E=3.7e-128

Best Hits

KEGG orthology group: None (inferred from 75% identity to xau:Xaut_1379)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (917 amino acids)

>GFF2372 hypothetical protein (Xanthobacter sp. DMC5)
MDEWALLVLVVLAFPVMALVAFIMALRSRGRIRLLEARVAALEAHAGLAPAAASPAWTQM
PPAEMPQPKESPLARLARPPQPPAPVAPAAEGGESPTVPPARPQPESTQPALPPPPAIDA
AKLKERLAGFEEKVGARWAVWVGGLALALGGVFLVRFAVEQDLIGPGLRVSLGLLLALVL
LGAGEWLRRREGKDPAAPITSLRGLVPDVPSILTAAGTMTAFGSIFAAYELYHLIPPQAA
FLLLAATGVATLLAALLHGPALGALGFVGAALTPFLVTTSSPNAWGVALLIAVVGASALG
VARIRRWRGLALLAIAGMVAWGLTLIVFEVPQAVTASGALGLVLLALTAALLAPGFLWGP
EAGERPEPISILGAVGALAVTAAAAVDGNVAAGPLAVFVVGAVGVLALAWRVRPLTFATF
AVALLAPAILTQWVFPPDAGSTLAPAGPMAGAVAEPERLSIGHFMVFAFAMGALMLSAGA
LGAGRGGRSRTVLGWAVTGTVGPVLMLIAAYARLTELERSLPFAALALALAFLFTLGAER
LLKGARTHAATVFAAAGVVSLSLALTFALEKGWLTVSLALAACGVAWVSTIRPLPGLRQF
SAALGVVVLSRIIWLPTIATDPGATPIFNWLLWGYGVPALAFAGAAYFLAKSKDDWARRV
HECLALIFAMLLAATEVRHLAHGGDIYAVGTRLFETGLLAVVYGAYAVGLSRLANVTGRG
FYRLFSDIVAAAATVCALNGLIETNPFATGEAVGGPIFNDLLIAYALPAGLALAFAAGQP
EIRPRVRTAARAIAGVLALAYVTLEVSRLFQGPVLSGDAISSAEWYAWSAAWLVFGMVLL
ALGLWRGSRSLRLASAAVMVATVLKVFLSDMADLEGVLRAVSFIGLGLVLVAMGWVYQRL
LAREKSRPAAPEAPPPA