Protein Info for PS417_01200 in Pseudomonas simiae WCS417

Annotation: phosphoesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 61 to 85 (25 residues), see Phobius details amino acids 99 to 117 (19 residues), see Phobius details amino acids 163 to 181 (19 residues), see Phobius details amino acids 188 to 207 (20 residues), see Phobius details amino acids 213 to 232 (20 residues), see Phobius details amino acids 242 to 258 (17 residues), see Phobius details PF01569: PAP2" amino acids 124 to 232 (109 residues), 33.4 bits, see alignment E=1.7e-12

Best Hits

KEGG orthology group: None (inferred from 89% identity to pfs:PFLU0265)

Predicted SEED Role

"Membrane-associated phospholipid phosphatase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TYJ4 at UniProt or InterPro

Protein Sequence (266 amino acids)

>PS417_01200 phosphoesterase (Pseudomonas simiae WCS417)
MNNPGLFQAKWNLGRWAFCNLLAIGLLCFWLWPTGQMLCVLFDEWLFHLLNDPLASNSTW
LHVWAVASLRPFDAVVGVILLSLLIRGDWVFKAVQVRQALLGFIGILLLLLFIRMLFSKF
AAHMGWQHSSPSMVISGAIQMSDFFPGLEKTWELKDRSSQSFPGDHASVLLIWGMFMTVF
AKRIGQVLVIWGLALLFMMPRLVAGAHWGQDDYIGGVLLALLALGWGYYTPFAAKVSSGL
LRVTAPVFGLLQHLPLIGRLSVVRPA