Protein Info for PS417_12070 in Pseudomonas simiae WCS417

Annotation: ribose 5-phosphate isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00689: sugar-phosphate isomerase, RpiB/LacA/LacB family
  • amino acids 7 to 149 (143 residues), 153 bits, E=5.1e-49
• TIGR01120: ribose 5-phosphate isomerase B
  • amino acids 7 to 148 (142 residues), 154.1 bits, E=2.3e-49
• PF02502: LacAB_rpiB
  • amino acids 7 to 144 (138 residues), 178.2 bits, E=4e-57

Best Hits

Swiss-Prot: 52% identical to DERI_PECAS: D-erythrulose-4-phosphate isomerase (derI) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K01808, ribose 5-phosphate isomerase B [EC: 5.3.1.6] (inferred from 95% identity to psb:Psyr_2572)

MetaCyc: 52% identical to D-erythrulose-4-phosphate isomerase (Pectobacterium atrosepticum SCRI1043)
RXN-17762 [EC: 5.3.1.34]

Predicted SEED Role

"Ribose 5-phosphate isomerase B (EC 5.3.1.6)" in subsystem Calvin-Benson cycle or D-ribose utilization or LMPTP YwlE cluster or Pentose phosphate pathway (EC 5.3.1.6)

MetaCyc Pathways

• superpathway of glucose and xylose degradation (16/17 steps found)
• formaldehyde assimilation III (dihydroxyacetone cycle) (11/12 steps found)
• pentose phosphate pathway (8/8 steps found)
• pentose phosphate pathway (non-oxidative branch) I (5/5 steps found)
• Bifidobacterium shunt (12/15 steps found)
• Rubisco shunt (8/10 steps found)
• pentose phosphate pathway (non-oxidative branch) II (5/6 steps found)
• Calvin-Benson-Bassham cycle (10/13 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (19/26 steps found)
• ethene biosynthesis V (engineered) (18/25 steps found)
• D-threitol degradation (2/3 steps found)
• erythritol degradation II (2/3 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (19/27 steps found)
• formaldehyde assimilation II (assimilatory RuMP Cycle) (6/9 steps found)
• L-threitol degradation (2/4 steps found)
• oxygenic photosynthesis (11/17 steps found)
• D-apionate degradation I (xylose isomerase family decarboxylase) (1/5 steps found)
• D-apionate degradation II (RLP decarboxylase) (1/5 steps found)
• erythritol degradation I (1/6 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Carbon fixation in photosynthetic organisms
• Pentose phosphate pathway

Isozymes

Compare fitness of predicted isozymes for: 5.3.1.6

Use Curated BLAST to search for 5.3.1.34 or 5.3.1.6

Sequence Analysis Tools

See A0A1N7UB53 at UniProt or InterPro

Protein Sequence (153 amino acids)

>PS417_12070 ribose 5-phosphate isomerase (Pseudomonas simiae WCS417)
MNTPFPVAIGCDEAGFELKELLKRHIEALGYPVTDFGTHSTAPVLYPDIALAVANAINAG
QQRLGVLVCGTGIGMAISANKVLGIRAAQAHDTYSAERARKSNDAQILSIGARVIGAELA
KSIVKSFLESEFESARSGAKVERINAIERDGHQ