Protein Info for PS417_12035 in Pseudomonas simiae WCS417

Annotation: dihydroxyacetone kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02365: dihydroxyacetone kinase, L subunit
  • amino acids 14 to 206 (193 residues), 163.8 bits, E=2e-52
• PF02734: Dak2
  • amino acids 34 to 206 (173 residues), 172.1 bits, E=5.3e-55

Best Hits

KEGG orthology group: K05879, dihydroxyacetone kinase, C-terminal domain [EC: 2.7.1.-] (inferred from 89% identity to psp:PSPPH_2723)

Predicted SEED Role

"Putative dihydroxyacetone kinase (EC 2.7.1.29), ADP-binding subunit" in subsystem Dihydroxyacetone kinases (EC 2.7.1.29)

MetaCyc Pathways

• formaldehyde assimilation III (dihydroxyacetone cycle) (11/12 steps found)
• glycerol degradation II (1/2 steps found)
• glycerol degradation to butanol (10/16 steps found)
• superpathway of glycerol degradation to 1,3-propanediol (1/4 steps found)

KEGG Metabolic Maps

• Glycerolipid metabolism
• Lipopolysaccharide biosynthesis
• Nicotinate and nicotinamide metabolism
• Pentose phosphate pathway

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.-, 2.7.1.29

Use Curated BLAST to search for 2.7.1.- or 2.7.1.29

Sequence Analysis Tools

See A0A1N7U8V5 at UniProt or InterPro

Protein Sequence (215 amino acids)

>PS417_12035 dihydroxyacetone kinase (Pseudomonas simiae WCS417)
MSQYFSTRDGGAIVSDLVSVIVANREYLSEIDGAIGDGDHGINMAKGFAHCGRTLEGRQL
TLAEALDELTLSLMEGIGGSMGPLYGSLFIGMADEVRNSDDIDAATFAHLLRGGLTSLQD
ITEAGVGDKCLMDTLIPAVEAFEQAHATGASFSEALDAMKAAASQGRDSTKDLVAKIGRA
SRLGERSLGVLDAGAVSCCLILTRLADSVQPRLSA