Protein Info for PS417_12035 in Pseudomonas simiae WCS417
Annotation: dihydroxyacetone kinase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: K05879, dihydroxyacetone kinase, C-terminal domain [EC: 2.7.1.-] (inferred from 89% identity to psp:PSPPH_2723)Predicted SEED Role
"Putative dihydroxyacetone kinase (EC 2.7.1.29), ADP-binding subunit" in subsystem Dihydroxyacetone kinases (EC 2.7.1.29)
MetaCyc Pathways
- formaldehyde assimilation III (dihydroxyacetone cycle) (11/12 steps found)
- glycerol degradation II (1/2 steps found)
- glycerol degradation to butanol (10/16 steps found)
- superpathway of glycerol degradation to 1,3-propanediol (1/4 steps found)
KEGG Metabolic Maps
- Glycerolipid metabolism
- Lipopolysaccharide biosynthesis
- Nicotinate and nicotinamide metabolism
- Pentose phosphate pathway
Isozymes
Compare fitness of predicted isozymes for: 2.7.1.-, 2.7.1.29
Use Curated BLAST to search for 2.7.1.- or 2.7.1.29
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A1N7U8V5 at UniProt or InterPro
Protein Sequence (215 amino acids)
>PS417_12035 dihydroxyacetone kinase (Pseudomonas simiae WCS417) MSQYFSTRDGGAIVSDLVSVIVANREYLSEIDGAIGDGDHGINMAKGFAHCGRTLEGRQL TLAEALDELTLSLMEGIGGSMGPLYGSLFIGMADEVRNSDDIDAATFAHLLRGGLTSLQD ITEAGVGDKCLMDTLIPAVEAFEQAHATGASFSEALDAMKAAASQGRDSTKDLVAKIGRA SRLGERSLGVLDAGAVSCCLILTRLADSVQPRLSA