Protein Info for GFF2360 in Variovorax sp. SCN45

Annotation: GGDEF domain protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 619 signal peptide" amino acids 1 to 36 (36 residues), see Phobius details transmembrane" amino acids 215 to 234 (20 residues), see Phobius details amino acids 241 to 261 (21 residues), see Phobius details amino acids 267 to 287 (21 residues), see Phobius details amino acids 307 to 325 (19 residues), see Phobius details amino acids 334 to 355 (22 residues), see Phobius details amino acids 362 to 387 (26 residues), see Phobius details amino acids 399 to 418 (20 residues), see Phobius details PF07696: 7TMR-DISMED2" amino acids 60 to 198 (139 residues), 63.2 bits, see alignment E=3.9e-21 PF07695: 7TMR-DISM_7TM" amino acids 211 to 415 (205 residues), 87.4 bits, see alignment E=2e-28 PF00990: GGDEF" amino acids 439 to 586 (148 residues), 133.9 bits, see alignment E=7.1e-43 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 440 to 589 (150 residues), 132.3 bits, see alignment E=7.2e-43

Best Hits

KEGG orthology group: None (inferred from 61% identity to aav:Aave_4205)

Predicted SEED Role

"FIG00349117: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (619 amino acids)

>GFF2360 GGDEF domain protein (Variovorax sp. SCN45)
MMSRLFPCGTADPRRAWRLLVAAALALFLSAIAAAQPAGNDAQRGPLQIRHQPNGLPAVQ
QLQVFEDKTRSLDIEQVRTPPQEARFAFPDDPLRGKESDRVLWFKLQMRLADPADAAREW
LMLVPTVSTHDLRFYGPYDEDGRALAAPVTTGMRYPWASRPAASEQMAWRFRLPGPGTYT
VYFRVESTFARIYDVSVWDPADYLQSTQDKRMFDGVSYGVLIGLMVYGLVLFKVFGEGLY
GFYMLSCACGVLALASINGHALRYPFAHWPAAAGFAYTAGPALWAICKLQFGRRLLRLRH
FAPPLDWLVQAFTVALALAIPYANWGAHPLMTFRLVQISVVASTVVMVIGALIAMRRRYW
PAVLYFFGVALLLAGIGAIVVASWGWIEWAPNQMNVSQGALVAELIVFAVAMGSRLQLVL
RSEQALTARTQQLVEALGTDALTGAASRAGFESRGEEWLHQGQPFALMLLDLDGFKGVND
AHGHAAGDQVLIAIAQRLRQQLRKDDVVARLGGDEFAVLVLGAPSREVLSLMARRMIEAG
SQPVEYEGRSVTVGMSLGIACRPGDGDTLARLLRAADRAMYHVKQHDAGPSFMFASDLAA
AAAAASAGGTQQNHQALSA