Protein Info for GFF2359 in Sphingobium sp. HT1-2

Annotation: Bacterial ribosome SSU maturation protein RimP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 174 PF02576: RimP_N" amino acids 10 to 84 (75 residues), 80.3 bits, see alignment E=1.2e-26 PF17384: DUF150_C" amino acids 87 to 152 (66 residues), 48 bits, see alignment E=1.2e-16

Best Hits

Swiss-Prot: 57% identical to RIMP_SPHWW: Ribosome maturation factor RimP (rimP) from Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273)

KEGG orthology group: K09748, ribosome maturation factor RimP (inferred from 92% identity to sjp:SJA_C1-16160)

Predicted SEED Role

"FIG000325: clustered with transcription termination protein NusA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (174 amino acids)

>GFF2359 Bacterial ribosome SSU maturation protein RimP (Sphingobium sp. HT1-2)
MADIAELTALIEPEVKALGFDLVRIKLFGSGDEYTLQIMAEDPKTKQLVIEDCAAISRRL
SDVMDEVDPIEEAYRLEVSSPGIDRPLTRLHDFLEWAGHEAKIAATEVVEGRKSFRGILK
GVEGEDILFQDAKAGDVTIPFALVGDAKLMLTDALISATMPLSSDGADEFETEE