Protein Info for GFF2358 in Variovorax sp. SCN45

Annotation: NAD kinase (EC 2.7.1.23)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 PF01513: NAD_kinase" amino acids 60 to 133 (74 residues), 61.4 bits, see alignment E=1.1e-20 PF20143: NAD_kinase_C" amino acids 158 to 282 (125 residues), 106.9 bits, see alignment E=6e-35

Best Hits

Swiss-Prot: 93% identical to NADK_VARPS: NAD kinase (nadK) from Variovorax paradoxus (strain S110)

KEGG orthology group: K00858, NAD+ kinase [EC: 2.7.1.23] (inferred from 96% identity to vpe:Varpa_4989)

Predicted SEED Role

"NAD kinase (EC 2.7.1.23)" in subsystem NAD and NADP cofactor biosynthesis global (EC 2.7.1.23)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.23

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (303 amino acids)

>GFF2358 NAD kinase (EC 2.7.1.23) (Variovorax sp. SCN45)
MTSRFRHVALIGKYQASGARAQADARDGVMEGIGAFLESQGCKVFVERSTCEDDAADAPA
HPRYEALSVEEIGQRCDLGLVVGGDGTMLGIGRQLASYGIPLIGINRGRLGFITDIPIDN
YQATLIPMLAGEYEEDHRSLMHAQVMRDGASVFDALAMNDVVVNRGATSGMVELRVSVGR
HFVANQRADGLIIATPTGSTAYALSAGGPLLHPAVPGWVLVPIAPHTLSNRPVLLPDADE
IVIELVGGRDASANFDMQSLASLVIGDRVVVRRSEFRVRFLHPRGWSYFDTLRKKLHWNE
GGS