Protein Info for GFF2358 in Sphingobium sp. HT1-2

Annotation: Transcription termination protein NusA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 524 TIGR01953: transcription termination factor NusA" amino acids 11 to 348 (338 residues), 408.4 bits, see alignment E=2.2e-126 PF08529: NusA_N" amino acids 11 to 131 (121 residues), 117.8 bits, see alignment E=9.6e-38 PF00575: S1" amino acids 138 to 200 (63 residues), 33.3 bits, see alignment E=1.6e-11 PF13184: KH_5" amino acids 236 to 304 (69 residues), 96.9 bits, see alignment E=1.8e-31 PF07650: KH_2" amino acids 291 to 344 (54 residues), 24.9 bits, see alignment 4.5e-09 TIGR01954: transcription termination factor NusA, C-terminal duplication" amino acids 371 to 420 (50 residues), 60.8 bits, see alignment 1e-20 PF14520: HHH_5" amino acids 377 to 417 (41 residues), 17 bits, see alignment 2e-06

Best Hits

Swiss-Prot: 47% identical to NUSA_RICCN: Transcription termination/antitermination protein NusA (nusA) from Rickettsia conorii (strain ATCC VR-613 / Malish 7)

KEGG orthology group: K02600, N utilization substance protein A (inferred from 94% identity to sjp:SJA_C1-16170)

Predicted SEED Role

"Transcription termination protein NusA" in subsystem NusA-TFII Cluster or Transcription factors bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (524 amino acids)

>GFF2358 Transcription termination protein NusA (Sphingobium sp. HT1-2)
MANAISANKAELIAIANSVASEKMIDKAIVIEAMEDAIQRAARARYGAENDIRAKLDPDS
GDLRLWRVVEVVEVVEDYFKQVDLKQAAKLKKDAVVGDFIVDPLPAIDLGRIDAQSAKQV
IFQKVRDAERERQFDEFKDRVGEIITGVVKSVEFGHVVVNLGRAEGVIRRDQQIPREVVR
VGDRIRSVVLNVRRENRGPQIFLSRAHPEFMKKLFAQEVPEIYDGVITIMAAARDPGSRA
KIGVISRDSSIDPVGACVGMKGSRVQAVVQEMQGEKIDIIPWSEDTATFVVNALQPAQVA
RVVIDEEEERIEVVVPDDQLSLAIGRRGQNVRLASQLTGKAIDIMTEADASEKRQKEFVS
RSEMFQNELDVDETLSQLLVAEGFGELEEVAYVSVEELAGIEGFDEDLAAELQSRAQEAL
DRREQAAREERQALGVEDALADMPHLTEAMLVTLGKAGVKTLDDLADLATDELVQKKRVD
QRRRKSDSGNEDKGGILAAYGLTDEQGNEIIMAARAHWFEGEEA