Protein Info for GFF2355 in Sphingobium sp. HT1-2

Annotation: Translation initiation factor 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 875 PF08364: IF2_assoc" amino acids 13 to 48 (36 residues), 41.5 bits, see alignment (E = 5.9e-14) TIGR00487: translation initiation factor IF-2" amino acids 294 to 874 (581 residues), 777.1 bits, see alignment E=1.3e-237 PF04760: IF2_N" amino acids 300 to 350 (51 residues), 50.2 bits, see alignment 8.2e-17 TIGR00231: small GTP-binding protein domain" amino acids 380 to 500 (121 residues), 103.8 bits, see alignment E=8.4e-34 PF00009: GTP_EFTU" amino acids 380 to 537 (158 residues), 112.2 bits, see alignment E=1.1e-35 PF02421: FeoB_N" amino acids 381 to 536 (156 residues), 27.9 bits, see alignment E=7.3e-10 PF01926: MMR_HSR1" amino acids 381 to 487 (107 residues), 42.7 bits, see alignment E=2.4e-14 PF22042: EF-G_D2" amino acids 553 to 632 (80 residues), 102.8 bits, see alignment E=4.1e-33 PF11987: IF-2" amino acids 652 to 764 (113 residues), 136.2 bits, see alignment E=2.3e-43

Best Hits

Swiss-Prot: 69% identical to IF2_NOVAD: Translation initiation factor IF-2 (infB) from Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CIP 105152 / NBRC 16084 / F199)

KEGG orthology group: K02519, translation initiation factor IF-2 (inferred from 88% identity to sjp:SJA_C1-16200)

Predicted SEED Role

"Translation initiation factor 2" in subsystem NusA-TFII Cluster or Translation initiation factors eukaryotic and archaeal or Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (875 amino acids)

>GFF2355 Translation initiation factor 2 (Sphingobium sp. HT1-2)
MSDSNEDKPVLGRKPLGIKRTVESGQVQQQFSHGRKNTVVVEVKRRRVPMGKLGESTGAA
PAAAPQADPTPAAPAAPAAPRPAAPAPQQRAPQPAPVRQAPPQSLMSRQELQAKLLREAE
EARMAALEDARRREDAARLAASEEEKRRAEENRQAAENAEVEAAKAAEAAEQAKVAEAAK
PAAPVEAPAAPAAATEPAAAAPAAPAAPATTSSTMPPPRRFTPVAPVKRPEPAKPDRAKR
NDDNRRQSGKLTVTRALADDDSARARSLAALKRAREKERRAHYSGGSQPREKQSRDVVVP
ESITVQELANRMAEKGADLVKALFKMGTAVTLNQPIDQDTAELLVEEFGHRIQRVSDADV
EIGMEGEADAPETLKPRAPVVTIMGHVDHGKTSLLDALRGTDVVAGESGGITQHIGAYQV
KTKSGDLITFLDTPGHEAFSEMRARGANVTDIVILVVAADDGLMPQTIEAINHTKAAGVP
MIVAINKCDKPDANPQKVRERLLSEEIVVEDMGGDVQDVEVSALKKTGLDELITKILLQA
EVMELTANPDRDAEGNVIEAQLDKGRGAVATVLVRKGTLKIGDTFVIGSESGKVRAMIND
KGQQVKTAGPSTPVEVLGLSGVPMAGDQLTVVENEARAREVAAYRQEQATKKRTTAAPTS
FEHMFSALNTKVIEYPVVVKGDVQGSVEAIVSSLNRISTDEIKVRILHSGVGAITESDVT
LAAASRAPLIGFNVRPNAKARQLAEREKISLRYYDVIYDLLEEVRGEMAGQLAPERIETI
VGRAEVLQVFPAGKKDKAAGLLVLDGIIRKGLAARLTRDDVIVSRTNIASLRRFKDDVSE
VRAGMECGAVLQDTNDIKPGDTLELFEVEERARTL