Protein Info for PS417_11975 in Pseudomonas simiae WCS417

Annotation: diguanylate cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 TIGR00229: PAS domain S-box protein" amino acids 13 to 134 (122 residues), 38.2 bits, see alignment E=1.4e-13 PF08447: PAS_3" amino acids 37 to 121 (85 residues), 50.5 bits, see alignment E=3.2e-17 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 141 to 309 (169 residues), 152.5 bits, see alignment E=8.4e-49 PF00990: GGDEF" amino acids 146 to 306 (161 residues), 149.8 bits, see alignment E=8.6e-48

Best Hits

KEGG orthology group: None (inferred from 95% identity to pfs:PFLU2606)

Predicted SEED Role

"FOG: PAS/PAC domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UH10 at UniProt or InterPro

Protein Sequence (314 amino acids)

>PS417_11975 diguanylate cyclase (Pseudomonas simiae WCS417)
MSIDPPSQPDSDVYKTLLESTKAIPWRIDWQTMTFNYIGPQIETLLGWPPQSWVSVDDWV
ERMHPDDREYVVNFCVSQSRAGVDHEADYRALTVNGDYVWIRDVVHVVRKDGEVEALIGF
MFDISERKKTEEHLLRLQKQLEEYSYQDGLTGIGNRRMFDTVLEREWTSAQRSQLPLSLI
ILDIDFFKQYNDHYGHIKGDECLRQVAHTLSQAANRPRDFIARIGGEEFVWLLPETDAQS
ARQVAQRCLHLIRQQQIEHGFSAVSNLLTLSLGVGTCIVKPDSPMLGFVEEVDKLLYQAK
RNGRMRAEFADSEV