Protein Info for GFF2346 in Xanthobacter sp. DMC5

Annotation: Riboflavin transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 43 to 64 (22 residues), see Phobius details amino acids 84 to 102 (19 residues), see Phobius details amino acids 108 to 127 (20 residues), see Phobius details amino acids 134 to 153 (20 residues), see Phobius details amino acids 159 to 177 (19 residues), see Phobius details amino acids 189 to 209 (21 residues), see Phobius details amino acids 215 to 238 (24 residues), see Phobius details amino acids 247 to 266 (20 residues), see Phobius details amino acids 272 to 290 (19 residues), see Phobius details PF00892: EamA" amino acids 17 to 149 (133 residues), 47.8 bits, see alignment E=9e-17 amino acids 159 to 284 (126 residues), 43.3 bits, see alignment E=2.2e-15

Best Hits

KEGG orthology group: None (inferred from 80% identity to xau:Xaut_1906)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (298 amino acids)

>GFF2346 Riboflavin transporter (Xanthobacter sp. DMC5)
MRAPGDSKVTPAPAPLVGIALMCLAVMSFAVTDTTAKWLSAHINVLIVVWARYVIHFALS
LVVFNPWTVPGLMRTQRPGLQIIRSALLFATTALNFTALQFLQLDQTVSIMFSIPFFVAL
FAGPLLGERVGLERWLAIIVGFAGILLVVRPGAGGIHPAAILSLVAAATYALYSITTRML
ARTDASKTTLFYTALVGSVVASIPLPFVWETPRDPAVIGAMVGLGAVAGAGHFVLILAHA
RAPAATLAPYIYTQILSMIALGWLVFGQVPSLWTLAGAAIVIASGAYLLVRDAQMRPH