Protein Info for GFF2344 in Xanthobacter sp. DMC5

Annotation: Transcriptional regulator SlyA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 163 PF01047: MarR" amino acids 37 to 91 (55 residues), 36.3 bits, see alignment E=8.1e-13 PF12802: MarR_2" amino acids 40 to 89 (50 residues), 43.7 bits, see alignment E=5.1e-15 PF01325: Fe_dep_repress" amino acids 52 to 81 (30 residues), 26.7 bits, see alignment 1e-09 PF13463: HTH_27" amino acids 54 to 99 (46 residues), 23.7 bits, see alignment E=9.5e-09

Best Hits

KEGG orthology group: None (inferred from 87% identity to xau:Xaut_1908)

Predicted SEED Role

"Transcriptional regulator, MarR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (163 amino acids)

>GFF2344 Transcriptional regulator SlyA (Xanthobacter sp. DMC5)
MKDPVQKTIGYRLTHTARLQKALSARLLAALGLFPGQESVLKLLCEADGRTMGDLASALR
VRPPTASKTIARLTTQGLVERRATDGDGRLVRVFLTDAGRERGASIDNVWDQLEAEMVLG
LDSKEKKRLRKLLRKVEKNLALRLGADGGLDDEAEPGDEDEDA