Protein Info for GFF2342 in Sphingobium sp. HT1-2

Annotation: Two-component system sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 339 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 46 to 64 (19 residues), see Phobius details amino acids 71 to 91 (21 residues), see Phobius details amino acids 97 to 117 (21 residues), see Phobius details PF13493: DUF4118" amino acids 23 to 120 (98 residues), 48.1 bits, see alignment E=1.3e-16 PF07568: HisKA_2" amino acids 145 to 217 (73 residues), 50.2 bits, see alignment E=3.4e-17 PF02518: HATPase_c" amino acids 242 to 337 (96 residues), 47.2 bits, see alignment E=4.2e-16

Best Hits

KEGG orthology group: None (inferred from 66% identity to sjp:SJA_C1-16270)

Predicted SEED Role

"Two-component signal transduction histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (339 amino acids)

>GFF2342 Two-component system sensor histidine kinase (Sphingobium sp. HT1-2)
MQRSNERFVERLPLVLPRPVYGYALSLLLCMLAWLARVAAETLLPVGYPFVTFFPAVILS
SFLFGVRPGIFAAIIGGLLSWYCFIPPFYALAFNPGVAMALIFYTMVVAVDILLIHFMQR
ANFNLAVERERSRALAENRELLFRELQHRVSNNLQVVAAMLSLQRRQIDNDVARRALDDA
AARLALIGKISRALYDPSGQGQELRAFMVMLCADIVDASGRTDIDCTICAPDGLSLEPDV
IVPLALIVAESVSNAIEHGLPDRAGRVAVTLEQQTGGALQLRIVDDGRGLPDGTMPDGPT
SIGLRIAVALAQQLGGRFRLEPAPDGGAMACLDLPQQTR