Protein Info for GFF2340 in Xanthobacter sp. DMC5

Annotation: Phosphate import ATP-binding protein PstB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 274 TIGR00972: phosphate ABC transporter, ATP-binding protein" amino acids 28 to 274 (247 residues), 394.7 bits, see alignment E=7.5e-123 PF00005: ABC_tran" amino acids 43 to 199 (157 residues), 114.4 bits, see alignment E=6.3e-37

Best Hits

Swiss-Prot: 69% identical to PSTB_GRABC: Phosphate import ATP-binding protein PstB (pstB) from Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)

KEGG orthology group: K02036, phosphate transport system ATP-binding protein [EC: 3.6.3.27] (inferred from 94% identity to xau:Xaut_0200)

MetaCyc: 68% identical to phosphate ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-27-RXN [EC: 7.3.2.1]; 7.3.2.1 [EC: 7.3.2.1]

Predicted SEED Role

"Phosphate transport ATP-binding protein PstB (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.27

Use Curated BLAST to search for 3.6.3.27 or 7.3.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (274 amino acids)

>GFF2340 Phosphate import ATP-binding protein PstB (Xanthobacter sp. DMC5)
MTSAVDPTFNLASAVGAKPDAPQAPAKIKVENLQFYYGSNHALRNINFEVPEKRVTAMIG
PSGCGKSTLLRVFNRMFDLYPGQRAEGSVMFDGVNIVGKELDPTIVRTRIGMVFQKPTPF
PMSIYDNIAFGVKLHERLSKSQMDERVEWCLRKAAIWDETKDRLHTSALGMSGGQQQRLC
IARTIAVKPEVILLDEPTSALDPISTSKIEDLIDELKQDFTIVIVTHNMQQAARCADMTA
FFYLGELIEVAPSDVIFTNPKEIKTRDYITGRFG