Protein Info for GFF2339 in Xanthobacter sp. DMC5

Annotation: Phosphate transport system permease protein PstA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 277 transmembrane" amino acids 16 to 37 (22 residues), see Phobius details amino acids 65 to 91 (27 residues), see Phobius details amino acids 106 to 128 (23 residues), see Phobius details amino acids 134 to 152 (19 residues), see Phobius details amino acids 188 to 206 (19 residues), see Phobius details amino acids 250 to 273 (24 residues), see Phobius details TIGR00974: phosphate ABC transporter, permease protein PstA" amino acids 14 to 274 (261 residues), 269.5 bits, see alignment E=1.4e-84 PF00528: BPD_transp_1" amino acids 84 to 272 (189 residues), 63.6 bits, see alignment E=1e-21

Best Hits

Swiss-Prot: 59% identical to PSTA_PASMU: Phosphate transport system permease protein PstA (pstA) from Pasteurella multocida (strain Pm70)

KEGG orthology group: K02038, phosphate transport system permease protein (inferred from 95% identity to xau:Xaut_0199)

MetaCyc: 52% identical to phosphate ABC transporter membrane subunit PstA (Escherichia coli K-12 substr. MG1655)
ABC-27-RXN [EC: 7.3.2.1]; 7.3.2.1 [EC: 7.3.2.1]

Predicted SEED Role

"Phosphate transport system permease protein PstA (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.3.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (277 amino acids)

>GFF2339 Phosphate transport system permease protein PstA (Xanthobacter sp. DMC5)
MASLAARRATDRAVKAISTGFAVFALFLLGWILWTLLSRGLPALGSNVFTQVTKPPGQGG
GLLNAIVGSLIQIGIAMVIGGPIGIFCGTFLAENGRGTKIGAAARFVNDILLSAPSILVG
LFIYTLLVVPFGGFSGWAGSLALAILVIPVIVRTTEDMLNLVPVGLREAAFALGAPQWKV
VMFITWRAARAGIVTGVLLAIARAAGETAPLLFTSLGNNAMSTDLSKPMASLPIAIYQFA
GSPFDDWVSLAWAGALLITVGVLVLNVASRLFLARGH