Protein Info for GFF2335 in Sphingobium sp. HT1-2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 49 to 68 (20 residues), see Phobius details amino acids 88 to 106 (19 residues), see Phobius details amino acids 133 to 153 (21 residues), see Phobius details amino acids 160 to 179 (20 residues), see Phobius details amino acids 185 to 205 (21 residues), see Phobius details amino acids 212 to 229 (18 residues), see Phobius details amino acids 235 to 253 (19 residues), see Phobius details amino acids 260 to 282 (23 residues), see Phobius details amino acids 294 to 315 (22 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 10 to 312 (303 residues), 107.3 bits, see alignment E=4.5e-35

Best Hits

KEGG orthology group: None (inferred from 52% identity to sjp:SJA_C1-06500)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (342 amino acids)

>GFF2335 hypothetical protein (Sphingobium sp. HT1-2)
MMGQGRTRLQELDALRGIAAFSVLLFHYFNIYPKLFPQGHRLPPLFEHGGYGVLLFFAIS
GFVIAFSLEGTRSAADFAVKRFARLFPVYWAAMALSIGIVLLLGADQLLPPAWVIPVNMT
MLQGYFYLPAVDGVYWTLGVELAFYCCMLAIWMGRGFARLEWLLLGWLAIKAAIAGWQAM
PSRLVMLLVLDYIPFFIIGMLFYRIWSGHRRWGQQALFFLAALATIAWADPREYLVAALL
VMAIFAAMLRGWLPFLRHRLLLWLGAISYALYLIHHNAGLAIMNLVDRAGLSTWIGFVLA
TAASLLLASALTYGVERPAARRINRWWRDRTASQGQRATQAG