Protein Info for PS417_11900 in Pseudomonas simiae WCS417

Annotation: conjugal transfer protein TraR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 134 PF21157: DksA_N" amino acids 19 to 88 (70 residues), 30.4 bits, see alignment E=4e-11 PF01258: zf-dskA_traR" amino acids 92 to 126 (35 residues), 48.4 bits, see alignment E=7.4e-17

Best Hits

KEGG orthology group: K06204, DnaK suppressor protein (inferred from 100% identity to pfs:PFLU2586)

Predicted SEED Role

"C4-type zinc finger protein, DksA/TraR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UEG8 at UniProt or InterPro

Protein Sequence (134 amino acids)

>PS417_11900 conjugal transfer protein TraR (Pseudomonas simiae WCS417)
MTKEKLLAMPADDYMNAEQHAFFEKLLQDMKVEHHERIEQNRIAIESLDTPADPADAASV
EEERTWLVNAIDRDQRMLPQLERALERIKEDSFGWCDDSGEPIGLKRLLISPTTKYCIEA
QERHEQIDKHQRQA