Protein Info for GFF2334 in Sphingobium sp. HT1-2

Annotation: Transcriptional regulator, HxlR family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 130 PF01638: HxlR" amino acids 27 to 112 (86 residues), 96.7 bits, see alignment E=3.1e-32

Best Hits

Swiss-Prot: 38% identical to YTFH_ECOLI: Uncharacterized HTH-type transcriptional regulator YtfH (ytfH) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 55% identity to bbt:BBta_5518)

Predicted SEED Role

"Transcriptional regulator, HxlR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (130 amino acids)

>GFF2334 Transcriptional regulator, HxlR family (Sphingobium sp. HT1-2)
MTAPTPLPRIGDAYDPDCPTRHVLDRIGDKWAVLVMLTLKDGPVRFNDLRRRIGAISQKM
LSQTLKSLERDGLVSRAAYATVPVTVEYRLTEMAQGLIGILDQITRWAEGHVGAIMDARR
AHDAREVEAA