Protein Info for PS417_11890 in Pseudomonas simiae WCS417

Updated annotation (from data): Inositol transport system ATP-binding protein
Rationale: specific phenotype on inositol. SEED_correct
Original annotation: D-ribose transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 517 PF00005: ABC_tran" amino acids 39 to 189 (151 residues), 115.3 bits, see alignment E=3.3e-37 amino acids 288 to 442 (155 residues), 83.7 bits, see alignment E=2e-27

Best Hits

Swiss-Prot: 87% identical to RGMG_PSEF5: Putative ribose/galactose/methyl galactoside import ATP-binding protein (PFL_2594) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)

KEGG orthology group: K02056, simple sugar transport system ATP-binding protein [EC: 3.6.3.17] (inferred from 97% identity to pfs:PFLU2584)

Predicted SEED Role

"Inositol transport system ATP-binding protein" in subsystem Inositol catabolism

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.17

Use Curated BLAST to search for 3.6.3.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U5S8 at UniProt or InterPro

Protein Sequence (517 amino acids)

>PS417_11890 Inositol transport system ATP-binding protein (Pseudomonas simiae WCS417)
MLAQATVSQPPSLQPQTLEEPYLLEIVNISKGFPGVVALADVQLRVRPGTVLALMGENGA
GKSTLMKIIAGIYQPDAGEIRLRGKPIVFETPLAAQKAGIAMIHQELNLMPHMSIAENIW
IGREQLNSLHMVNHREMHRCTAELLARLRINLDPEEQVGNLSIAERQMVEIAKAVSYDSD
ILIMDEPTSAITEKEVAHLFSIIADLKSQGKGIVYITHKMNEVFAIADEVAVFRDGHYIG
LQRADSMNSDSLISMMVGRELSQLFPLRETPIGDLLLTVRDLTLDGVFKDVSFDLHAGEI
LGIAGLMGSGRTNVAETIFGITPSSSGQITLDGKAVRISDPHMAIEKGFALLTEDRKLSG
LFPCLSVLENMEMAVLPHYTGNGFIQQKALRALCEDMCKKLRVKTPSLEQCIDTLSGGNQ
QKALLARWLMTNPRLLILDEPTRGIDVGAKAEIYRLIAFLASEGMAVIMISSELPEVLGM
SDRVMVMHEGELMGTLDRSEATQEKVMQLASGMTAVH