Protein Info for PS417_11870 in Pseudomonas simiae WCS417

Updated annotation (from data): 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase IolD (EC 3.7.1.22)
Rationale: Specifically important for utilizing m-Inositol.
Original annotation: 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 643 TIGR04377: 3,5/4-trihydroxycyclohexa-1,2-dione hydrolase" amino acids 5 to 641 (637 residues), 959.8 bits, see alignment E=3.4e-293 PF02776: TPP_enzyme_N" amino acids 31 to 134 (104 residues), 50.9 bits, see alignment E=1.9e-17 PF00205: TPP_enzyme_M" amino acids 221 to 353 (133 residues), 107.8 bits, see alignment E=5.5e-35 PF02775: TPP_enzyme_C" amino acids 439 to 598 (160 residues), 118.1 bits, see alignment E=4.5e-38

Best Hits

Swiss-Prot: 67% identical to IOLD_BACC3: 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase (iolD) from Bacillus cereus (strain 03BB102)

KEGG orthology group: K03336, 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase [EC: 3.7.1.-] (inferred from 97% identity to pfs:PFLU2579)

MetaCyc: 56% identical to 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase (Bacillus subtilis subtilis 168)
RXN-14149 [EC: 3.7.1.22]

Predicted SEED Role

"Epi-inositol hydrolase (EC 3.7.1.-)" in subsystem Inositol catabolism (EC 3.7.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.7.1.- or 3.7.1.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U2X7 at UniProt or InterPro

Protein Sequence (643 amino acids)

>PS417_11870 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase IolD (EC 3.7.1.22) (Pseudomonas simiae WCS417)
MTTTRLTMAQALVKFLDNQYIEVDGVQSKFVAGVFTIFGHGNVLGLGQALEQDAGDLVVH
QGRNEQGMAHAAIGFAKQHLRRKIYACTASVGPGAANMLTAAATATANRIPLLLLPGDVY
ASRQPDPVLQQIEQFHDLSISTNDAFRSVSKYWDRINRPEQLMTAAIHAMRVLTDPAETG
AVTLALPQDVQGEAWDYPDYFLQKRVHRIDRRPATAAMIGDALAAFRGKRKPLIICGGGV
KYSGANATLQAFAERFDIPFAETQAGKSAVVSSHPLNVGGIGETGCLAANLLAPEADLII
GIGTRYTDFTTSSKSLFKHAEVKFLNLNISPCDALKLDGVQVLADAHVALEALADALGDY
RSGWGGQIAEAKAQLEAEVDRVHQVEYAGDGFVPEVDDHLDRTVLREFIELTGSCLTQSR
VLGVLNEALADDAIIVAAAGSLPGDLQRAWRSKGVNTYHVEYGYSCMGYEINAALGVKLA
EPTKEVYALVGDGSYMMLHSELATSIQERRKINVVLLDNMAFGCINNLQIGNGMDSFGTE
FRYRNPESGKLDGGLVPVDFAMSAAAYGCKTYKVSSVEQLEAALADARKQTVSTLIDIKV
LPKTMIHGYLSWWRVGVAQVSTSERTNAAAKKLNEHLAKARQY